KEGG   Ornithorhynchus anatinus (platypus): 100077550Help
Entry
100077550         CDS       T01045                                 

Definition
uncharacterized LOC100077550
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1127 aa AA seqDB search
MVLMLSLIGRGPRPEGRWPVESGRGQDRPRGRTVGAKAMEEPGGPGPEPVRRLLAIYTGG
TIGMRSQRGVLIPGQNLVAALRKLPMFHDEEFSRGHDLPADTLALPCQPPRLPISRTACV
RRLDGSARSLTSQNKRIVYTVLECRPLFDSSDMTIEEWTKIAKDIEVTQRLGLACEVPEP
VVLIPGQNLVAALRKLPMFHDEEFSRGHDLPADTLALPLTSQNKRIVYTVLECRPLFDSS
DMTIEEWTKIAKDIEANYDTYHGFVVIHGTDTMAFATSMLSFMLGNLQKTVILTGAQVPI
HALWNDGRENLLGSLLMAGQFVIPEVCLFFQNQLFRGNRVTKVDSRKFAAFCSPNLPPLA
LIGADITINYELMMRPNLKKQLLVHTNMERNVGVLRLYPGITAAMVRSFLQPPMQGMVME
TFGTGNGPTAGDLLRELKDATERGMIIINCTHCLQGHVTSDYAAGLAIAGTGIISGSDMT
SEAALAKLSYVLGRADLNLEGKKELLRKNLRGEMTPLPEDYRISLRDSKFVQVVAKYLGL
SNSQELDAVRDALTPSLACAAARTGDLEALDAILDMGGDLSQGDFDGRTPLHVAAREGHL
ETVQRLLRHGARVGATDRDRASPLLAAVKGRHLDVIDALRAAGAELSPQELQGVGTELCR
LAANGDVDGLMVWRQAGADWAEVGYTGQSPLQVVSPGAAEVHTPPCLSLHASRIRGPSGT
SHLALQPPRACRWTHWEGSRMPWISGPRCPVCLLIPMVVRLPVKRIPVSVVGEYGSSCFL
TQFPNCPQLSRHKLCFHAFISLLLAXXXXVQPQAVVSCFIYLPSQAEAAGKQEVVNVLRT
LGDRGQDDLYPSFHSHEGGQSCGGEVMPEEESGSGTSWEKPNDGPANPEDQCHPVGAQIG
KDKGMLRGSPRVMPDRASGANGKLGGGYFQTRHGPRRGPTTSWPMTPDFCGISETSGPGP
QHFALVSWLLPISLSPANLLLGSSCQPTTLHALHTPAKGQAGLPTGTLFDRSTSPRGRSC
RLTPSPISHFTGLEAKASFLPPQNAGLLEVHEIQVSGSAFQSEPFEFGNLICISQTAPAL
PYVNTCAELIRAAANSEKMINFHFAPSKSSANIVGGFYAIQRRRWEN
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atggttctgatgctgtcactgattggccggggccctcggccggagggtcgatggcctgtg
gagtccgggcgggggcaggaccggcccagaggccggacagtgggggcgaaggccatggag
gagcccgggggcccgggtccggagccggtgcggcgtctgctggccatctacacggggggc
accatcggcatgcggagccagaggggcgtgctcatccccggacagaatttggttgcagct
ctgaggaagcttccgatgttccacgatgaagaattcagccggggccacgacctcccagca
gacacgctggctctgccctgccagcctccccgactccccatctccagaacggcttgcgtg
cgcaggctggatggcagtgcccgcagcctcaccagccaaaacaagaggatcgtatacacc
gtcttggagtgccggcctctcttcgactcaagcgatatgaccatcgaagagtggacgaag
attgccaaggacatcgaggtaactcagcggctgggcttagcttgtgaagtacctgaaccc
gtggtgctcatccccggacagaatttggttgcagctctgaggaagcttccgatgttccac
gatgaagaattcagccggggccacgacctcccagcagacacgctggctctgcccctcacc
agccaaaacaagaggatcgtatacaccgtcttggagtgccggcctctcttcgactcaagc
gatatgaccatcgaagagtggacgaagattgccaaggacatcgaggccaactacgacacc
tatcatggcttcgtcgtcattcacggtaccgacaccatggcctttgccacatccatgctc
tccttcatgctggggaatctccagaaaaccgtcatcctaaccggagcccaggtccccatc
cacgcgctgtggaacgacgggagggaaaatctgctggggagcctgctcatggccgggcag
ttcgtcatcccggaggtgtgcctgtttttccagaatcagctgttcaggggaaacagggtg
acgaaggtggactccaggaaatttgcagctttctgctccccgaacctgcctccactggct
ctgatcggagcggatatcacaattaactacgagctgatgatgagaccaaacctgaagaag
cagctcctggtccacaccaacatggagaggaatgtcggggtgctgaggctgtaccccgga
atcaccgccgccatggtgaggagcttccttcagcccccgatgcagggcatggtgatggag
acgttcggcacggggaacgggccgaccgccggggacctgctgcgggagctgaaggacgcc
acggagcgcggcatgatcatcatcaactgtacccactgcctccagggacacgtcacctcg
gactacgctgctggcctggcgattgctggcaccggcatcatctctgggtcagacatgacc
tctgaggctgccctggcgaagctctcctacgtcctgggccgcgctgacctcaacctggag
ggcaagaaggagctactgaggaagaacctgagaggggagatgacgccgttgcccgaggac
tacaggatctccctgcgggacagcaagttcgtgcaggtggtggccaagtacctcggcctc
agcaacagtcaggaactcgatgctgtccgagatgccctcacgccctctctggcctgtgcc
gcggccaggacaggtgaccttgaggctctggacgccatcctggacatggggggagacctg
agccagggggactttgatggacgtactcccctgcacgtggctgcccgtgaagggcacctg
gaaactgtgcagaggctgctccgtcacggggcccgagtcggagccacggaccgggacagg
gccagtcccctgctggcagcggtcaagggcaggcacctggacgtgatcgatgcgctgcga
gctgctggggccgagctttcaccgcaggagctgcaaggagttggcacagaactctgcagg
ctggctgcgaatggagacgtagacgggctgatggtgtggcggcaagccggggcggattgg
gctgaggtgggctacaccggccagagccccttgcaagtggtgagtcctggtgcggccgag
gtccacacccctccatgcctctcccttcatgccagcaggattcggggcccctctggcact
tcccaccttgccctccagccccctcgagcctgccgctggacccactgggaagggagccgg
atgccatggataagtggcccaagatgcccagtctgtctcctcatccccatggttgtgcgc
ctccctgtcaagagaatcccagtgtcagtggtgggcgagtatgggtcttcttgttttctg
actcaatttcccaactgtccacagctgtcccgtcacaagctgtgttttcatgctttcatt
tctctcctcctcgcannnnnnnnnnctgtccagccacaagctgtggtttcatgcttcatt
tacctcccctcgcaggcagaggcggccgggaagcaggaggtggtcaacgttttaaggact
ctgggtgacagaggacaggatgacctgtatccttctttccacagccatgaaggtggccag
tcttgtggaggggaagtcatgcctgaggaggagtctgggtcaggaacctcctgggagaag
ccaaacgatggccctgccaacccagaggaccagtgccatccagtgggggcccagataggc
aaagacaaaggaatgctcagagggtctcccagggtgatgccagacagagcatcgggagcc
aacggcaaacttggaggtgggtatttccagacccggcatgggccacggaggggccccacg
acctcctggccgatgacccctgacttttgtggcataagcgagacgtcaggtcctggaccc
caacactttgcccttgtgagctggctgctccccatcagtttatcaccagcaaacctgctc
ctcgggagcagctgccagcccaccaccctccatgctctccacactcctgccaagggacag
gctgggctaccgacagggacactctttgatcggtccacctctcccagaggccggagctgc
aggttaacccccagcccaattagtcattttactggattagaagccaaggcctccttcctt
cctccccagaatgcagggctgctggaggttcatgaaatccaggtcagtggatcagccttt
cagagcgagccctttgaatttggtaatctgatctgtatttctcagacggcacccgcatta
ccatatgtcaatacctgtgctgaattgattagagcggcagccaacagtgagaaaatgatc
aattttcatttcgctcctagcaaatcttctgctaacattgttgggggattttacgctatc
cagcgacgtcgctgggaaaattga

DBGET integrated database retrieval system