KEGG   Ornithorhynchus anatinus (platypus): 100077609Help
Entry
100077609         CDS       T01045                                 

Definition
(RefSeq) histone acetyltransferase KAT8-like
  KO
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100077609
Chromosome [BR:oaa03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100077609
   HAT complexes
    NSL complex
     100077609
    MSL complex
     100077609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 170 aa AA seqDB search
CPSRSPHPADSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKEAVQK
NSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAVSEGLRPDG
PTPRDCGVGSGWIVAEPHLSSFCFFLSPAVDSVCLKWAPPKHKQVKLSKK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
tgcccgtcccgttctccccaccccgcagactcggccgaggtgatccagtctcgggtgaac
gaccaagagggacgagaggaattctacgtgcactacgtgggctttaaccggcggctggac
gaatgggtagacaagaaccgcctggcgctaaccaagaccgtgaaggaggccgtgcagaag
aactcggagaagtacctgagcgagctggccgagcagcccgagcgcaagatcacccgcaac
cagaaacgcaaacacgatgaaatcaaccacgtccagaagacctatgcggagatggacccc
accacggcggccctggagaaagaacacgaggcggtaagtgaggggctgaggccagacggc
ccaacccctcgagactgtggggttggctcaggctggattgttgctgagccacacttgagc
tccttctgttttttcctatcccctgcagtggactctgtctgcctcaaatgggccccaccg
aagcacaaacaagtgaagctgtccaagaagtga

DBGET integrated database retrieval system