KEGG   Ornithorhynchus anatinus (platypus): 100077694Help
Entry
100077694         CDS       T01045                                 

Definition
calcium-activated potassium channel subunit beta-1-like
Orthology
K04937  
potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Vascular smooth muscle contraction
Insulin secretion
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:oaa04911]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:oaa04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X1
AA seq 191 aa AA seqDB search
MGKKLVTAQKRGETRALCLGVVMVFGSVIAYYILGTTLLPLYQKSVWSQVSKCHLIEANI
KDQEELDGRNVPQYPCLWVNVTALGKWAMLYHTEETKEKNHQCSYIPTHLENYRKARLDV
EKIKANFKEHQAFLCYHDPEENERSVLYTRLYGPQVLFSSLFWPTFMLIGGVLIIIMVKI
NQSLSVLVAQH
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaactagtgacagcccagaagcgaggggagacccgagcgctttgtctaggt
gtggtcatggtatttggctcggtcatcgcctactatatcctggggaccaccctgttgccc
ctgtatcagaagagtgtgtggtcacaggtctccaaatgccatctgattgaggccaacatt
aaagaccaggaagagctggatggcaggaatgtcccccagtacccctgcctatgggtcaat
gtgactgccttgggaaaatgggccatgctgtaccacacagaggagacgaaggagaaaaat
catcagtgctcatacataccaacccacctggagaactaccgcaaagcaagattagacgtg
gagaagataaaggcgaatttcaaagagcatcaggctttcctttgctaccacgaccctgag
gaaaatgagaggagcgtcttatacacacgactctatgggccccaggtcctgttctcttct
ctcttctggccaaccttcatgttgatcgggggagtcctgatcattattatggttaaaatc
aaccaatcactttctgtactcgtggctcagcactag

DBGET integrated database retrieval system