KEGG   Ornithorhynchus anatinus (platypus): 100077747Help
Entry
100077747         CDS       T01045                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100077747
Peptidases [BR:oaa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100077747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 113 aa AA seqDB search
MEGHRWLPLEANPEVTNQFLKQLGLYPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSKGQDVTSSVYFMKQTISNACGTIGLIHAIANNRDKMNF
NT seq 340 nt NT seq  +upstreamnt  +downstreamnt
atggagggtcaccgctggctgcccctggaggccaaccccgaggtgaccaaccagttcctt
aaacaacttggtttatatccaaactggcagtttgtggatgtgtatggaatggatccagag
ctcctgagcatggtgccaagacctgtctgtgcagtcttacttctcttcccgattacagaa
aagtatgaagtgttcagaacagaagaggaggagaaaataaaatctaaaggacaggatgtt
acatcatcggtatattttatgaagcaaaccatcagtaatgcctgtggaacaattgggcta
attcatgcaattgctaataatagagacaaaatgaactttg

DBGET integrated database retrieval system