KEGG   Ornithorhynchus anatinus (platypus): 100077802Help
Entry
100077802         CDS       T01045                                 

Gene name
PBK
Definition
PDZ binding kinase
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100077802 (PBK)
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   100077802 (PBK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 321 aa AA seqDB search
MEGTNMFKTPSKLPEKKKSASFTTPTIAIPASPFMQKLGYGTGVNVYLMKRSPKGLSQSP
WAVKKINPKCDDHYQSIYQKRLNDEAKILKNLQHPNIVGYRAFTEAHDGSMCLAMEYGGE
KSLNDLIEERNSKSRDPFPAVTILKVALNMARGLKYLHNEKKLLHGDIKSSNVVIKGDFE
AVKICDVGVSLPLDENLTVSDPNVHYIGTEPWKAKEALEDGVITDKADIFAFGLTLWEMM
TLSIPHINLPEDDDDEDKTFDEDDFDDEAYYEALGTRPALNMDELDDSYQTVIELFSVCT
NEDPKERPSAAQIVQALEDIE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaacaaacatgttcaagacccctagcaaattgcctgagaagaagaaatctgca
tcatttacaactcctaccatagctattccagcctctccatttatgcaaaagcttggttat
ggaactggggtaaatgtttaccttatgaaaagatctcccaagggcttatctcagtctccc
tgggctgtgaaaaagattaatcctaaatgtgatgatcactatcaaagtatatatcaaaag
agactgaatgatgaagctaaaattttgaaaaaccttcagcatcctaatatcgtaggttac
cgtgctttcactgaagctcatgatggtagcatgtgccttgctatggagtatggcggggaa
aagtctctcaatgacttaatagaagaaagaaattccaaaagccgggatcctttcccagca
gtcacaattctcaaagttgctttgaacatggccagaggtttaaagtatctgcacaatgaa
aagaaactgcttcatggagacatcaaatcttcaaatgttgtaattaaaggagattttgaa
gcagttaagatctgtgatgtgggtgtttccctgcccctggatgaaaatcttactgtgagt
gaccctaatgtacattacattggcactgagccgtggaaagccaaggaggctctggaggat
ggtgttatcactgataaagcggacatctttgcttttgggctaactctctgggagatgatg
acactatccattccacatattaatctgccagaggacgatgatgatgaggataaaacattt
gatgaagatgacttcgatgatgaggcatattatgaggctctgggaaccaggccagccctc
aatatggatgaactggacgactcctaccagacggtgatagaactgttttctgtctgtacc
aacgaggatccaaaagagcgcccttcagctgcacaaattgttcaggctttagaagacata
gagtaa

DBGET integrated database retrieval system