KEGG   Ornithorhynchus anatinus (platypus): 100077802Help
Entry
100077802         CDS       T01045                                 

Definition
lymphokine-activated killer T-cell-originated protein kinase-like
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 321 aa AA seqDB search
MEGTNMFKTPSKLPEKKKSASFTTPTIAIPASPFMQKLGYGTGVNVYLMKRSPKGLSQSP
WAVKKINPKCDDHYQSIYQKRLNDEAKILKNLQHPNIVGYRAFTEAHDGSMCLAMEYGGE
KSLNDLIEERNSKSRDPFPAVTILKVALNMARGLKYLHNEKKLLHGDIKSSNVVIKGDFE
AVKICDVGVSLPLDENLTVSDPNVHYIGTEPWKAKEALEDGVITDKADIFAFGLTLWEMM
TLSIPHINLPEDDDDEDKTFDEDDFDDEAYYEALGTRPALNMDELDDSYQTVIELFSVCT
NEDPKERPSAAQIVQALEDIE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaacaaacatgttcaagacccctagcaaattgcctgagaagaagaaatctgca
tcatttacaactcctaccatagctattccagcctctccatttatgcaaaagcttggttat
ggaactggggtaaatgtttaccttatgaaaagatctcccaagggcttatctcagtctccc
tgggctgtgaaaaagattaatcctaaatgtgatgatcactatcaaagtatatatcaaaag
agactgaatgatgaagctaaaattttgaaaaaccttcagcatcctaatatcgtaggttac
cgtgctttcactgaagctcatgatggtagcatgtgccttgctatggagtatggcggggaa
aagtctctcaatgacttaatagaagaaagaaattccaaaagccgggatcctttcccagca
gtcacaattctcaaagttgctttgaacatggccagaggtttaaagtatctgcacaatgaa
aagaaactgcttcatggagacatcaaatcttcaaatgttgtaattaaaggagattttgaa
gcagttaagatctgtgatgtgggtgtttccctgcccctggatgaaaatcttactgtgagt
gaccctaatgtacattacattggcactgagccgtggaaagccaaggaggctctggaggat
ggtgttatcactgataaagcggacatctttgcttttgggctaactctctgggagatgatg
acactatccattccacatattaatctgccagaggacgatgatgatgaggataaaacattt
gatgaagatgacttcgatgatgaggcatattatgaggctctgggaaccaggccagccctc
aatatggatgaactggacgactcctaccagacggtgatagaactgttttctgtctgtacc
aacgaggatccaaaagagcgcccttcagctgcacaaattgttcaggctttagaagacata
gagtaa

DBGET integrated database retrieval system