KEGG   Ornithorhynchus anatinus (platypus): 100077897Help
Entry
100077897         CDS       T01045                                 

Gene name
PPT1
Definition
(RefSeq) palmitoyl-protein thioesterase 1
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00062  Fatty acid elongation
oaa01100  Metabolic pathways
oaa01212  Fatty acid metabolism
oaa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    100077897 (PPT1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100077897 (PPT1)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100077897 (PPT1)
Lipid biosynthesis proteins [BR:oaa01004]
 Fatty acid synthase
  Component type
   100077897 (PPT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest
Motif
Other DBs
NCBI-GeneID: 100077897
NCBI-ProteinID: XP_007670203
Position
Un
AA seq 209 aa AA seqDB search
DSCCNPLSMGSIKKMVESKIPGIYVLSLEIGKTVMEDMENSFFMNVNHQVSTVCEMLSKD
PKLQQGYNAMGFSQGGQFLSGQAKETVRLQETALYAQTLTKSPPSVGMRTFISEDLALTI
SQSSELVLRYTWQPSVLLMEMGTPWGGFVTGPWTPPPDHRPSWCSLVQAEYWHDPVKEEL
YRNCSIFLADINQEREFNETYKRNLMALK
NT seq 629 nt NT seq  +upstreamnt  +downstreamnt
gagacagctgttgtaaccccttgagcatgggatccattaaaaaaatggtggagagtaaaa
tacccgggatttatgttttatctctagagattggcaagaccgtgatggaggatatggaaa
acagtttcttcatgaacgtcaaccaccaagtgtcaaccgtgtgtgagatgctctccaagg
atcccaagttgcaacagggctacaacgctatgggattttcccaaggaggccagttcctaa
gcggccaggccaaagaaaccgttcgtttgcaggagactgccttgtacgcccagacactta
cgaaatcaccgccctcggtggggatgaggacgttcatctcggaagacttggcactgacga
tctcgcagtcgagcgagctcgtgctcaggtacacgtggcagccgtcggtcttgttgatgg
agatgggtaccccgtgggggggatttgtgactggcccttggacccccccccccgatcacc
gcccctcatggtgcagcttggtgcaggccgaatattggcacgacccggtgaaggaggagc
tgtaccgcaactgcagcatcttcttggccgacatcaaccaggagagggagttcaatgaaa
cgtacaagaggaacctgatggcgctgaag

DBGET integrated database retrieval system