KEGG   Ornithorhynchus anatinus (platypus): 100078104Help
Entry
100078104         CDS       T01045                                 

Gene name
DLAT
Definition
dihydrolipoamide S-acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:oaa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:oaa00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:oaa00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:oaa00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 523 aa AA seqDB search
VETDKATVGFESMEECYLAKILVAEGTRDVPIGAIICITVEKPEYIEAFKNYTLDSAGPP
AAAAAPPAPPAPPPPSAAAPPPSAQPPGSSYPPHLQVQLPALSPTMTMGTVQRWEKKVGE
KLSEGDLLAEIETDKATIGFEVQEEGYLAKILVAEGTRDVPLGTPLCIIVEKEADIPAFA
DYQPTAVVDMKPQPSPSTPASAAAFAASPQPASPAPPAARPAAPAGSKARLYVSPLARKL
ATEKGIDLAQVKGTGPDGRITKKDIDSFVPSRAAPAPAAAVPSLTPEVAVAPAGVFTDIP
VSNIRRVIAQRLMQSKQTIPHYYLSVDVNMGEVLLVRKELNKMLAGSSKISVNDFIIKAS
ALACLKVPEANSSWLDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGLESIANDVVSL
AAKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDRLVPAENER
GFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKFLEKPINMLL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
gtggagacggacaaggccaccgtggggtttgagagcatggaggagtgttacttagccaag
atcctcgtcgccgagggaaccagggacgtgcccatcggggccatcatctgcatcaccgtg
gaaaagcccgagtacatcgaagcctttaaaaactacactctggattcggcggggccccca
gcggcggccgcggctcctcccgctcctcccgctcctcctcccccgtctgcagctgcccca
ccaccctccgctcagcctccagggagctcctacccgcctcatttgcaggtccaactcccg
gccctgtccccgaccatgaccatgggcaccgtgcagaggtgggagaagaaggtgggcgag
aagctgagcgaaggggatctgctggctgagatcgagaccgacaaggccaccatcggcttt
gaggttcaggaggaaggttacctggcgaagatcctggtggcagaaggcacgagggacgtg
cccctgggcaccccgctgtgtatcatcgtggagaaggaggcggacattcctgcgttcgcg
gactaccagccgacggcggtggtggacatgaaaccccagccctcgccatccaccccggcc
tcggcggcagccttcgctgcttctccgcagcccgcttcgcctgcccccccggccgcccgc
cccgccgcccctgctggctcaaaggcgaggctctacgtcagccccctcgccaggaaactg
gccaccgagaagggcatcgacctggcccaggtgaaagggaccggaccggatggcaggatc
accaagaaagacatcgactcattcgtgccttccagggccgcgcccgctccagctgcggcg
gtgcccagcttgactcccgaggtggcggtcgcgcccgccggcgtcttcaccgacatcccg
gtcagcaacattcgccgagtgatcgctcagcggctgatgcagtccaagcagaccatccct
cactactacctctccgtggacgtgaacatgggagaagttttgctggtccggaaggagctc
aacaagatgctggcggggagcagtaagatttcggtcaacgacttcatcatcaaggcttcg
gccctggcctgcctgaaggtgcccgaagcaaattcctcttggctggacaccgtcatccgg
cagaaccacgtggttgacgtgagcgtggccgtgagcacccccgcgggactcatcacgccc
atcgtcttcaacgcgcacatcaaagggttggaatccatcgccaacgacgtcgtctccttg
gcagccaaggctcgagaggggaaactccagccccatgagttccagggcggcaccttcacc
atctccaatttaggcatgtttgggataaagaacttctctgccatcatcaacccgcctcag
gcctgcatcttggcgatcggggcttccgaggacaggctggtgccagcagagaacgagagg
gggttcgacgtggccagcatgatgtccgtcacgctgagctgtgaccaccgggtggtggac
ggggccgtgggagcccagtggctggcggagttccggaagtttttggagaagcccatcaac
atgctgctatga

DBGET integrated database retrieval system