KEGG   Ornithorhynchus anatinus (platypus): 100078328Help
Entry
100078328         CDS       T01045                                 

Gene name
EHMT1
Definition
euchromatic histone-lysine N-methyltransferase 1
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:oaa00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1239 aa AA seqDB search
MAADESSAEKQGGEPQLVTDVETNGSCEGGEATDPPSPAQNTQDSIKATQPDPAAKLGRV
AENGLSERDVEGGKPNAAKSSELTQTSVTGSNGFILTKATSQEQALRTTSTPAPSLPGHA
AKTLPGGAGKGRTLSTLSPIQAAPSAKAGEGSEERDTKKAPAPNSDVKVHRARKTMPKST
PNPHTANKDSRDVRDARDLKEPKEDSNKNVSEFGKQQLLPPLPSLHQSLPQNQGYVATAK
SQTASLPFVLAAAVSRKKKRRMGTYSLVPKKKTKGLKQRTMIEMFKSITHSTAGVKNDKD
LGDGSLHLNGESLEMDSDEEDSDELEDEDDRGTDQPSAYPAEDSRTSKESVSETEHAPKV
EDGESEEEQDSGESGEEEEDGDESDLSSESSIKKKLLKRKGKTDSPWIKPSRKRRRRNKK
KPGSGLGTETYKPSLGSTEQSRQENSMEYMEVSLDSLDLRVKGILSSPSEALSNGPEIVE
TDGLQEVPLCSCRMETPKSREITTLANNQCMATESVDNELGRCTNSVVKYELMRPSNKVQ
LLVLCEDHRGRMVKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCASQVNDTSYCPHC
GEEASKAKEVTIAKADTTSTVSLTYEQEKPVSAEGRADTTTGSGVGTLLSEEEKPESSTS
QAPEGFDGAGASVLAKPTAGLSQGPVKETLESALIALDSEKPKKLRFHPKQLYFSARQGE
LQKVLLMLVDGIDPNFKMEHQNKRTPLHAAAESGHVDICHMLIQAGANIDTCSEDQRTPL
MEAAENNHLDAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYDVVQYLLSNGQMDVNCQD
DGGWTPMIWATEYKHVDLVKLLLAKGSDINIRDNEENICLHWAAFSGCVDIAELLLAAKC
DLHAVNIHGDSPLHIAARENRYECVVLFLSRGSDVSLKNKEGETPLQCSSLNSQVWVTLQ
MNKTLQESPTDKPTQVEKTMSRDIARGYERIPIPCVNAVDNEPCPSNYKYVSQNCVTSPM
NIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACS
CWRNCRNRVVQNGLRTRLQLYRTQNMGWGVRSLQDIPLGTFVCEYIGELISDSEADVREE
DSYLFDLDNKDGEVYCIDARFYGNVSRFINHLCEPNLIPVRVFMSHQDLRFPRIAFFSTR
PIEAGEELGYVRQRRQGLASDPILVPIPCRLFFPPPEAK
NT seq 3720 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgacgaaagttctgccgagaagcaaggaggggagccccagctggtgacggac
gtggaaaccaacggctcctgtgaggggggcgaagccaccgaccccccgagccccgcccag
aacactcaggacagcatcaaggcaacccagccggaccccgccgccaagctgggccgggtc
gccgaaaacgggctctcggaaagagacgttgaaggggggaagcccaacgccgccaagtcg
agcgaactcacacagacctctgtcacggggagcaatgggtttatcctcacaaaggccacc
tcccaagagcaggccttaaggactacgagtaccccggccccctcgctgcccggtcacgcc
gccaaaaccctccccggaggagccggcaaagggagaactctgagcacgctgtctccgatc
caagccgcgccgtcggccaaggccggggaaggcagcgaggagcgggatactaaaaaagcc
ccggcccccaacagcgacgtcaaggtccacagagcccggaagacgatgccgaaatccacc
cccaacccgcacacagcaaataaggactcccgcgacgtgcgagatgctagagatcttaag
gaacccaaggaggacagtaacaaaaatgtctcggagtttggaaaacagcagcttttaccc
cctctcccgtcccttcatcagtcgctacctcagaaccagggttacgtggccaccgcaaaa
tcacagacagccagcttgccttttgtcttagcagctgcagtatctcggaagaaaaaacgg
agaatgggaacctatagcctggttcccaagaaaaagaccaaagggttgaaacagaggacg
atgatcgagatgtttaaaagcataactcattccactgcgggggtcaagaacgacaaggac
ctaggagatggtagccttcacctcaacggggagagcttagagatggactcggacgaagag
gactcggacgagctggaagacgaggacgatcgggggactgaccaaccctctgcgtatcct
gcagaagacagcaggacttctaaagagagcgtgtccgaaacagaacatgccccaaaggtg
gaggatggcgaatccgaagaggaacaggattcgggggaatccggcgaagaggaggaggat
ggagatgaatctgacttgagttcagaatccagcatcaagaagaaattactgaagagaaaa
gggaaaacggacagtccgtggatcaaaccatccaggaaaaggaggaggagaaataaaaag
aaaccaggcagcgggctcggtacagaaacatataagccatctttgggaagcacagagcaa
tccaggcaggaaaacagtatggaatacatggaagtttctctcgattctttagacctgcga
gtcaagggaattctctcttcgccgtcggaagctctttctaacggtccagaaatagtggaa
accgatggtcttcaggaagtgcccctctgcagctgtcgaatggagacccccaaaagccga
gagattaccaccttagccaacaatcagtgcatggcaacggaaagtgtggacaatgagttg
ggcaggtgcaccaacagcgtggttaagtacgagctgatgcgtccgtccaataaagtccag
cttctggtactgtgtgaggaccacagagggaggatggtgaagcaccagtgctgcccgggc
tgtgggtacttctgcacagctggcaacttcatggaatgccagcccgagagcagcatctcg
caccgcttccacaaggactgcgcctctcaagtcaacgacacgagctactgcccccactgt
ggcgaggaagcctcaaaggccaaggaggtgaccatcgccaaggccgacaccacctccacg
gtgtccttgacctacgagcaagaaaagccagtctctgcggagggcagggcagacactacg
acgggaagcggcgttggaacactgctctccgaggaagagaagcccgagagttccacatct
caagcccccgagggcttcgatggcgccggggcttcggtcttggcgaaacccaccgccggc
ctatcccagggacccgtgaaagaaaccttggaaagcgccctgatcgccctggattccgaa
aagccgaagaaactgcgcttccatccgaagcagctgtacttctccgcccgacaaggagaa
ctgcagaaagtgctgctgatgttggttgatggaatcgacccaaacttcaaaatggagcac
cagaataaacggactcccctccatgcagcagctgagtctggccacgtggacatctgtcat
atgttgattcaggctggtgccaacatagatacctgctccgaggaccaaaggacccctcta
atggaggcagcagaaaacaaccatctggatgccgtgaagtacctcatcaaggccggagca
ctagtagatcccaaggatgcagaaggttccacgtgtttgcacttggctgccaagaaaggc
cattatgatgtggttcagtatctgctctccaatggacaaatggatgtcaactgtcaggat
gacggcggttggacaccgatgatctgggccaccgagtacaagcacgtcgacctcgtgaaa
ctactcctcgccaaagggtcggacattaacatccgagacaacgaggagaatatctgcttg
cactgggcagccttctcaggttgcgtcgacatagcggagctcttgctggctgccaagtgc
gatttgcacgccgtcaacatccacggagactcccccctgcacatcgccgcccgggagaac
cgctatgaatgtgtggtcctgtttctctctcgtggctctgatgtcagcttgaagaataag
gagggtgagaccccactgcagtgctcaagtctcaactctcaggtctgggtgactctgcag
atgaacaagaccctccaagaatcgcccactgacaaacccacccaggtagagaagacgatg
agcagagacatcgcccgaggctacgagcgaattcccattccctgcgtcaacgcggtggac
aacgagccttgcccgagcaactataagtacgtttcccagaactgcgtcacgtcgcccatg
aacatcgacagaaacatcacccacctgcagtactgcgtctgcatagacgattgttcctct
agcaactgcatgtgtggacaactcagtatgcgctgttggtatgataaggatggtcgactg
ttgccggaattcaacatggcagagccaccgttgatctttgagtgtaaccacgcctgttcg
tgttggaggaattgccgcaaccgggttgtccaaaacggactcaggacgcgattacaactg
taccggacacaaaatatgggctggggcgtccgatccttgcaagacattccactgggaacc
ttcgtgtgcgagtacatcggggagctgatttcggactcggaagcggacgtgcgggaagag
gactcctacctctttgacctcgacaacaaggacggagaggtgtactgcatagacgctcgt
ttctatggtaacgtcagccgcttcatcaatcatctctgcgagcccaacctcatccccgtg
cgtgtcttcatgtcccaccaggatttacgcttcccccggatcgccttcttcagcacccgg
ccgattgaggcgggagaggaactagggtacgtacgccagcgtcgccagggcctggcttcc
gatcccatcctagttccaatcccctgccgcctcttcttccctccacccgaggccaaatga

DBGET integrated database retrieval system