KEGG   Ornithorhynchus anatinus (platypus): 100078328Help
Entry
100078328         CDS       T01045                                 

Gene name
EHMT1
Definition
(RefSeq) euchromatic histone lysine methyltransferase 1
  KO
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Lysine degradation
Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100078328 (EHMT1)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    100078328 (EHMT1)
Enzymes [BR:oaa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100078328 (EHMT1)
Chromosome [BR:oaa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100078328 (EHMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1446 aa AA seqDB search
MQEGVEIWRPWQLYRPAGNQFEVQLCAGWQHAVLNKGETKGETCMKTELLKDITNNKEEG
CNAMAADESSAEKQGGEPQLVTDVETNGSCEGGEATDPPSPAQNTQDSIKATQPDPAAKL
GRVAENGLSERDVEGGKPNAAKSSELTQTSVTGSNGFILTKATSQEQALRTTSTPAPSLP
GHAAKTLPGGAGKGRTLSTLSPIQAAPSAKAGEGSEERDTKKAPAPNSDVKVHRARKTMP
KSTPNPHTANKDSRDVRDARDLKEPKEDSNKNVSEFGKQQLLPPLPSLHQSLPQNQGYVA
TAKSQTASLPFVLAAAVSRKKKRRMGTYSLVPKKKTKGLKQRTMIEMFKSITHSTAGVKN
DKDLGDGSLHLNGESLEMDSDEEDSDELEDEDDRGTDQPSAYPAEDSRTSKESVSETEHA
PKVEDGESEEEQDSGESGEEEEDGDESDLSSESSIKKKLLKRKGKTDSPWIKPSRKRRRR
NKKKPGSGLGTETYKPSLGSTEQSRQENSMEYMEVSLDSLDLRVKGILSSPSEALSNGPE
IVETDGLQEVPLCSCRMETPKSREITTLANNQCMATESVDNELGRCTNSVVKYELMRPSN
KVQLLVLCEDHRGRMVKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCASQVNDTSYC
PHCGEEASKAKEVTIAKADTTSTVSLTYEQEKPVSAEGRADTTTGSGVGTLLSEEEKPES
STSQAPEGFDGAGASVLAKPTAGLSQGPVKETLESALIALDSEKPKKLRFHPKQLYFSAR
QGELQKVLLMLVDGIDPNFKMEHQNKRTPLHAAAESGHVDICHMLIQAGANIDTCSEDQR
TPLMEAAENNHLDAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYDVVQYLLSNGQMDVN
CQDDGGWTPMIWATEYKHVDLVKLLLAKGSDINIRDNEENICLHWAAFSGCVDIAELLLA
AKCDLHAVNIHGDSPLHIAARENRYECVVLFLSRGSDVSLKNKEGETPLQCSSLNSQVWV
TLQMNKTLQESPTDKPTQVEKTMSRDIARGYERIPIPCVNAVDNEPCPSNYKYVSQNCVT
SPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNH
ACSCWRNCRNRVVQNGLRTRLQLYRTQNMGWGVRSLQDIPLGTFVCEYIGELISDSEADV
REEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHLCEPNLIPVRVFMSHQDLRFPRIAFF
STRPIEAGEELGYVRQRRQGPGGGGGGVGGPGGPGGGGGLGGPGGVQPAQRPPYKQSKAQ
RTRAMALYNPIPVKQNCFTVNRSLFVFSEDNIIRKYAKRITEWPPFEYMILATIIANCIV
LALEQHLPDGDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVFHKGSYLRNGWNVMDF
VVVLTG
NT seq 4341 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagggggtggaaatatggaggccctggcaactctacaggcctgctggcaaccaa
tttgaggtgcagctgtgtgcagggtggcagcatgcagtgttgaataaaggggagacaaag
ggggagacgtgcatgaagactgagctgctcaaagatatcaccaacaataaagaagaaggg
tgtaatgccatggcggccgacgaaagttctgccgagaagcaaggaggggagccccagctg
gtgacggacgtggaaaccaacggctcctgtgaggggggcgaagccaccgaccccccgagc
cccgcccagaacactcaggacagcatcaaggcaacccagccggaccccgccgccaagctg
ggccgggtcgccgaaaacgggctctcggaaagagacgttgaaggggggaagcccaacgcc
gccaagtcgagcgaactcacacagacctctgtcacggggagcaatgggtttatcctcaca
aaggccacctcccaagagcaggccttaaggactacgagtaccccggccccctcgctgccc
ggtcacgccgccaaaaccctccccggaggagccggcaaagggagaactctgagcacgctg
tctccgatccaagccgcgccgtcggccaaggccggggaaggcagcgaggagcgggatact
aaaaaagccccggcccccaacagcgacgtcaaggtccacagagcccggaagacgatgccg
aaatccacccccaacccgcacacagcaaataaggactcccgcgacgtgcgagatgctaga
gatcttaaggaacccaaggaggacagtaacaaaaatgtctcggagtttggaaaacagcag
cttttaccccctctcccgtcccttcatcagtcgctacctcagaaccagggttacgtggcc
accgcaaaatcacagacagccagcttgccttttgtcttagcagctgcagtatctcggaag
aaaaaacggagaatgggaacctatagcctggttcccaagaaaaagaccaaagggttgaaa
cagaggacgatgatcgagatgtttaaaagcataactcattccactgcgggggtcaagaac
gacaaggacctaggagatggtagccttcacctcaacggggagagcttagagatggactcg
gacgaagaggactcggacgagctggaagacgaggacgatcgggggactgaccaaccctct
gcgtatcctgcagaagacagcaggacttctaaagagagcgtgtccgaaacagaacatgcc
ccaaaggtggaggatggcgaatccgaagaggaacaggattcgggggaatccggcgaagag
gaggaggatggagatgaatctgacttgagttcagaatccagcatcaagaagaaattactg
aagagaaaagggaaaacggacagtccgtggatcaaaccatccaggaaaaggaggaggaga
aataaaaagaaaccaggcagcgggctcggtacagaaacatataagccatctttgggaagc
acagagcaatccaggcaggaaaacagtatggaatacatggaagtttctctcgattcttta
gacctgcgagtcaagggaattctctcttcgccgtcggaagctctttctaacggtccagaa
atagtggaaaccgatggtcttcaggaagtgcccctctgcagctgtcgaatggagaccccc
aaaagccgagagattaccaccttagccaacaatcagtgcatggcaacggaaagtgtggac
aatgagttgggcaggtgcaccaacagcgtggttaagtacgagctgatgcgtccgtccaat
aaagtccagcttctggtactgtgtgaggaccacagagggaggatggtgaagcaccagtgc
tgcccgggctgtgggtacttctgcacagctggcaacttcatggaatgccagcccgagagc
agcatctcgcaccgcttccacaaggactgcgcctctcaagtcaacgacacgagctactgc
ccccactgtggcgaggaagcctcaaaggccaaggaggtgaccatcgccaaggccgacacc
acctccacggtgtccttgacctacgagcaagaaaagccagtctctgcggagggcagggca
gacactacgacgggaagcggcgttggaacactgctctccgaggaagagaagcccgagagt
tccacatctcaagcccccgagggcttcgatggcgccggggcttcggtcttggcgaaaccc
accgccggcctatcccagggacccgtgaaagaaaccttggaaagcgccctgatcgccctg
gattccgaaaagccgaagaaactgcgcttccatccgaagcagctgtacttctccgcccga
caaggagaactgcagaaagtgctgctgatgttggttgatggaatcgacccaaacttcaaa
atggagcaccagaataaacggactcccctccatgcagcagctgagtctggccacgtggac
atctgtcatatgttgattcaggctggtgccaacatagatacctgctccgaggaccaaagg
acccctctaatggaggcagcagaaaacaaccatctggatgccgtgaagtacctcatcaag
gccggagcactagtagatcccaaggatgcagaaggttccacgtgtttgcacttggctgcc
aagaaaggccattatgatgtggttcagtatctgctctccaatggacaaatggatgtcaac
tgtcaggatgacggcggttggacaccgatgatctgggccaccgagtacaagcacgtcgac
ctcgtgaaactactcctcgccaaagggtcggacattaacatccgagacaacgaggagaat
atctgcttgcactgggcagccttctcaggttgcgtcgacatagcggagctcttgctggct
gccaagtgcgatttgcacgccgtcaacatccacggagactcccccctgcacatcgccgcc
cgggagaaccgctatgaatgtgtggtcctgtttctctctcgtggctctgatgtcagcttg
aagaataaggagggtgagaccccactgcagtgctcaagtctcaactctcaggtctgggtg
actctgcagatgaacaagaccctccaagaatcgcccactgacaaacccacccaggtagag
aagacgatgagcagagacatcgcccgaggctacgagcgaattcccattccctgcgtcaac
gcggtggacaacgagccttgcccgagcaactataagtacgtttcccagaactgcgtcacg
tcgcccatgaacatcgacagaaacatcacccacctgcagtactgcgtctgcatagacgat
tgttcctctagcaactgcatgtgtggacaactcagtatgcgctgttggtatgataaggat
ggtcgactgttgccggaattcaacatggcagagccaccgttgatctttgagtgtaaccac
gcctgttcgtgttggaggaattgccgcaaccgggttgtccaaaacggactcaggacgcga
ttacaactgtaccggacacaaaatatgggctggggcgtccgatccttgcaagacattcca
ctgggaaccttcgtgtgcgagtacatcggggagctgatttcggactcggaagcggacgtg
cgggaagaggactcctacctctttgacctcgacaacaaggacggagaggtgtactgcata
gacgctcgtttctatggtaacgtcagccgcttcatcaatcatctctgcgagcccaacctc
atccccgtgcgtgtcttcatgtcccaccaggatttacgcttcccccggatcgccttcttc
agcacccggccgattgaggcgggagaggaactagggtacgtacgccagcgtcgccagggc
cccgggggaggaggcggcggggtcggcgggcccggagggcccggaggaggaggaggcctg
ggggggccggggggcgtccagcccgcccagcggccgccctacaagcagtccaaggcgcag
cgcacccgggccatggcgctgtacaaccccatccccgtcaagcagaactgcttcaccgtc
aaccgctccctcttcgtcttcagcgaggacaacatcatccgcaagtacgccaagcgcatc
accgagtggcctccgtttgaatatatgattctagcgacaatcatcgccaactgcatcgtc
ctggcactggagcagcacctgcctgacggagacaagacccccatgtccgagcgcctggac
gacaccgaaccctactttattggaatattttgctttgaggccgggataaaaatcatcgcc
ctgggatttgttttccataaaggctcctacctgcgcaacggctggaacgtgatggatttc
gtggtcgtcctcacgggataa

DBGET integrated database retrieval system