KEGG   Ornithorhynchus anatinus (platypus): 100078338Help
Entry
100078338         CDS       T01045                                 

Gene name
FLNC
Definition
filamin C, gamma
Orthology
K04437  
filamin
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100078338 (FLNC)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100078338 (FLNC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100078338 (FLNC)
  Infectious diseases
   05132 Salmonella infection
    100078338 (FLNC)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100078338 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 2676 aa AA seqDB search
MMNNSGYPEGPALGLGEEAEEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLGD
LQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPIT
NFNRDWQDGKALGALVDNCAPGLCPNWETWDPNQPVENAREAMQQADDWLGVPQVIAPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKATAYGPGIEPHGNTVLQPAHFT
VQTVDAGLGEVLVYIEDPEGHTEEAKVVPNNDKDRTFAVSYVPKVAGLHKVTVLFAGQNI
ERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQG
PAGHHCSVGVALEDKGDNTXXXSPQPVLEGPCLPTLGPPPLLSILPPPTPSTACNPNACR
AAGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYY
PVVPGKYVVTISWGGYAIPRSPFEVQVSPEAGTQKVRAWGPGLETGQVGKSADFVVEAVG
TEVGTLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQVKAFGPGLEPTGCIVDKPAEFTID
ARAAGKGDLKLYAQDAEGCPIDIKVQPNGDGTFRCSYVPTKPIKHTIIVTWGGVNVPKSP
FRVNVGEGSHPERVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPA
EADIDFDIIKNDNDTFTVKYTPPGAGHYTIMVLFANQEIPASPFHIKVDPSHDASKVKAE
GPGLNRTGVEVGKPTHFTVLTKGAGKAKLDVSFAGAAKGEAVRDFEIIDNHDYSYTVKYT
ALQQGNMAVTVTYGGDPVPKSPFVVNVAPPLDLSKVKVQGLNSKVAVGQEQAFSVNTRGA
GGQGQLDVRMTSPSRRPIPCKLEPGGGAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFA
VEGVLPPDPSKVCAYGPGLKGGLVGKPAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNG
DGSCAVSYLPTEPGEYSINILFAEAHIPGSPFKADIRPVFDPSKVRASGPGLERGKAGEA
ATFTVDCSEAGEAELTIEILSDAGVKAEVLIHNNADGTYHITYSPAFPGTYTITIKYGGH
PVPKFPARVRVHPAVDTSGVKVSGPGVEPHGVLREVTTEFTVDARSLTATGGNHVTARVL
NPSGAKTDTYITDNGDGTYRVQYTAYEEGVHLVEVLYDDVAVPKSPFRVGVTEGCDPTRV
RAYGPGLEGGLVNKANRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFT
PGDYDVNITFGGRPIPGSPFRVPVKDVVDPGKVKCSGPGLGAGVRARVPQTFTVDCSKAG
RAPLQVAVLGPTGVAEPVEVRDNGDGTHTANYTPATDGPYTVAVKYADQEVPRSPFKIKV
LPAHDASKVRASGPGLNAAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDN
GDGTYTVSYLPDMSGRYTITIKYGGDEIPYSPFRIHALPTGDASKCLVTVSIGGHGLGAC
LGPRIQIGEETVITVDAKAAGKGKVTCTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGK
YVITIRFGGEHIPNSPFHVLACDPIPHVEEPCDTLQLHQPFPPHRPSAYPAHWATEEPVA
PAEPLESMLRPFNLVIPFTVQKGEITGEVRMPSGKTARPNITDNKDGTITVRYAPSEKGL
HEMGIKYDGNHIPGSPLQFYVDAINSRQVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLS
LAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMR
TSQLNVGTSTDVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEH
VVSVRKSGKHVTNSPFKIFVGPSEIGDASKVRVWGKGLSEGHTFQVSEFIVDTRTAGYGG
LGLSIEGPSKVDINCEDMEDGTCKVTYCPTEPGNYIINIKFADKHVPGSPFTVKVTGEGR
MKESITRRRQAPSIATIGSTCDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEI
SKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGSITRQQEGETGSQDMTAQ
VTSPSGKTEEAEILEGEDSAYSVRFVPQEMGPHTVTVKYRGQHVPGSPFQFTVGPLGEGG
AHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSY
VVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTSLQETGLKVNQPASFAVQL
NGARGVIDARVHTPSGAVEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGSHIPGSPFK
IRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSEFIVNTVNAGSGALSVTIDGPSKVQLDCR
ECPEGHVVTYTPMAPGSYLIAIKYGGPQHIVGSPFKAKVTGPRLSGGHSLHETSTVLVET
VTKSSSSRGSSYSSIPKFSSDASKVVTRGPGLAKAFVGQKNSFTVDCSKAAKTAGHACPR
IGDAHAPQDCNLPPPTPHPHSPGADDLEKQIKDTDV
NT seq 8031 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaacagcggctaccccgagggcccggccctgggcctcggcgaggaggcggag
gagatgccgtccacggagaaggacctggcagaggacgcgccctggaagaagatccagcag
aacacgttcacccgctggtgcaacgagcacctcaagtgcgtgggcaagcggctgggcgac
ctgcagcgggacctgagcgacgggctgcggctcatcgcgctgctcgaggtgctcagccag
aagcgcatgtaccgcaaattccacccgcgacccaatttccgccagatgaagctcgagaac
gtgtccgtggccctcgagttcctggagcgtgagcacatcaagctcgtgtccatcgacagc
aaggccatcgtggatgggaacctaaagctgatcctggggctgatctggaccctgatcctg
cactactccatctccatgcccatgtgggaggatgaggacgacgaggatgcccgcaaacag
acccccaagcagcggctgctgggttggatccagaacaaggtgccccagctgcccatcacc
aacttcaaccgtgactggcaggatggcaaggcactgggtgccctggtagacaactgtgcc
cccggcctgtgccccaactgggagacgtgggaccccaaccagcctgtggagaatgcccga
gaggccatgcagcaggctgacgactggctcggcgtgccccaggtgattgccccagaggag
atcgtggaccccaatgtggatgaacactctgtcatgacctacctgtcccagtttcctaaa
gccaagctcaagccaggggcccctgtgcgctccaagcagctgaaccccaaaaaagccaca
gcctatggacccggcatcgagccccatgggaacacggtgctgcagccagcccacttcacg
gtgcagacagtagacgcggggctgggggaagtgctggtctacatcgaggaccccgagggc
cacaccgaggaggctaaagtcgtgcccaataatgacaaggatcgaaccttcgctgtctcc
tatgtgcccaaggtggctggactgcacaaggtgacagtgctgttcgctggccagaacatc
gagcgaagccccttcgaggtgaatgtgggcatggccctaggagacgccaacaaggtgtca
gcccggggacctggcttggaacctgtgggaaatgtagccaacaaacccacctactttgat
atctacactgcaggggcaggcaccggcgacgtggccgtggtgatcgtggacccccagggc
ccggcgggacaccactgctcagttggagtcgcgctggaagacaagggtgacaacacgnnn
nnnngaagtccccagcctgtcctggagggtccatgtctcccaaccctgggccctccacct
ctcctgagcatcctcccacccccaactccctccacagcctgcaatcccaatgcctgtcgg
gccgcgggccggggcctccagcccaaaggagtgagggtgaaggaggtggctgacttcaag
gtgttcaccaagggcgccggcagtggggagctcaaggtcacagtcaagggtccaaagggc
acggaggagcccgtgaaggtccgggaggctggtgacggcgtgttcgagtgtgaatactac
ccagtggtccccgggaagtatgtggtcaccatcagctggggtggctatgccataccccgc
agccccttcgaggtgcaggtgagccccgaggccggaactcagaaggtgcgagcctggggc
cctggcctggagacaggacaagtgggcaagtcggctgactttgtggtggaggccgtcggc
acggaggtggggacactggaacccacaggctgtattgtggacaaaccagccgagtttacc
atcgatgcccgggccgcgggcaagggcgacctcaagctctatgcccaggtaaaggctttt
ggtccggggctagaacccacaggctgtattgtggacaaaccagccgagtttaccatcgat
gcccgggccgcgggcaagggcgacctcaagctctatgcccaggatgctgaagggtgcccc
atagacatcaaagtccagcccaatggagatgggaccttccgttgctcctacgtgcccacc
aagcccatcaagcacaccatcatcgtcacctggggtggtgtcaatgtccccaagagtcct
ttccgggtgaacgtgggagaaggcagccacccagagcgggtgaaggtgtatggtcctggc
gtggagaagacagggctcaaagccaatgagcccacctacttcactgtggactgcagtgag
gccgggcaaggggacgtgagcattggcatcaagtgtgccccgggtgtggtgggccccgct
gaggctgacatcgacttcgacatcatcaagaatgacaacgacaccttcactgtcaagtac
acaccccctggggctggccactacaccattatggtgctgtttgccaaccaggagatcccg
gccagtcccttccacatcaaggttgacccatcccacgatgccagcaaggtgaaggccgag
ggccctgggctcaaccgcaccggtgtcgaagtggggaagcccacacatttcacagtgctg
accaagggggctggcaaggccaagctggatgtaagctttgctggagcagccaagggcgag
gccgtgcgggacttcgagatcatcgacaatcatgactactcctacactgtcaagtacacg
gccctccagcagggcaacatggcggtgacggtgacttacggtggggacccggtccccaag
agcccctttgtggtgaatgtggcgcctcctctggacctcagcaaggtcaaagttcaaggc
ctcaacagcaaggtggcagtggggcaggaacaggccttctccgtgaacacacgcggggcc
ggaggccagggtcagctggatgtccggatgacctctccctcgcgccggccaatcccctgc
aagctggagcccgggggtggggccgaggcccaggctgtgcgctacatgcctccagaggag
ggaccctacaaagtggacatcacctacgatggacatcccgtgcctggcagccccttcgcc
gttgagggtgtgctgcccccggatccttccaaggtgtgtgcctatgggccaggcctgaag
ggcgggctggtgggcaagccagcgccattctccatcgacaccaagggggcgggcaccggg
ggcctgggcctaacggtggagggcccctgcgaggccaagatcgagtgccaggacaatggg
gatggctcatgcgcggtcagctatctgccgacggagccgggcgaatactccatcaacatc
ctgttcgccgaggcccacatccccggctcccccttcaaggccgacatccggcccgtcttc
gaccccagcaaggtgcgggctagcgggccgggactggagcgcggcaaggcaggtgaggcg
gccaccttcaccgtggactgctcggaggcgggcgaggcggaactgaccatcgagatcctc
tcggacgccggtgtcaaggccgaggtgctgatccataacaatgccgacggcacctaccac
atcacctacagccccgccttccccggcacctacaccatcaccatcaagtacggtggccac
cccgtacccaagttcccggcccgggtccgcgtccaccctgccgtcgacaccagcggcgtc
aaggtctccggccccggggtggagccccacggcgtcctgcgggaggtgaccaccgaattc
acagtggacgcacgctccctgaccgccacgggagggaaccacgtgacggctcgcgtgctt
aacccctcgggggccaagacggacacctacatcacagacaatggggacggcacttaccgg
gtgcagtacacggcctacgaagagggggtgcatctggtggaagtcctttacgatgacgtg
gctgtgcccaagagcccgttccgggtaggggtgaccgaaggctgtgacccaacccgagtc
cgcgcctatggccccggcctggagggaggacttgtcaataaagccaatcgcttcaccgtg
gagaccaggggggccggcaccgggggtctgggcctggccattgagggcccctcggaggcg
aagatgtcctgcaaggacaacaaagatggcagttgcagtgtggagtacatccctttcacc
cccggggactacgatgtcaacatcacctttggcgggcggcccattccaggaagtccattc
cgtgtgcccgtgaaggacgtggtagaccccggcaaagtgaagtgctcggggccggggctg
ggggctggggtccgggcccgcgtcccccagaccttcaccgtggactgcagcaaagccggc
cgagcccctcttcaagtggccgtgctggggcccacaggagtagccgagcccgtggaagtg
cgggataatggagatggcactcacactgcaaactacactccggccaccgatggtccctac
actgtggccgtcaagtatgctgaccaggaagtgcctcgcagccccttcaagatcaaggtg
ctgccagcccacgatgccagcaaggtgcgtgccagcggcccagggctcaacgccgcgggc
attcctgccagcctgcccgtcgagttcaccatcgatgcccgtgatgccggggaggggctg
ctcaccgtgcagattctggacccagaggggaagcctaagaaggcaaacatccgggacaat
ggggatggcacctacacagtgtcctacctgccagatatgagcggccgctataccatcacc
atcaagtacgggggtgatgagatcccctactcgcccttccgcatccacgccctgcccacc
ggggatgccagcaagtgtctcgtcacagtgtccatcgggggccacggcttgggcgcgtgc
ctaggtccacggatccagatcggagaagagacggtgatcacggtggatgccaaggcggca
gggaaaggcaaggtgacgtgcacggtgtccacgccggatggggcagagctggacgtggat
gtggtggagaaccacgacggcaccttcgacatctactacaccgcgcccgagccgggcaag
tacgtcatcaccatccgcttcggaggagagcacatccccaacagccccttccatgtgctg
gcgtgtgaccccatccctcacgtggaggagccatgtgacaccctgcagcttcaccagccc
ttccctccacaccggcccagcgcctatcccgcccactgggccacagaggagccggtggcc
ccagccgagcctctagagtccatgctgagacccttcaatctggtcatccccttcacagtc
cagaagggagagatcacaggtgaagtgcggatgccctcgggcaagacagcccgacccaac
atcacggacaacaaggatggcaccatcacagtgaggtatgcgcccagcgagaagggcctc
catgagatgggcatcaaatatgatggcaaccacatccctgggagccctctgcagttctac
gtcgacgcgatcaacagccgccaagtgagcgcctacgggccaggtctgagccacggcatg
gtcaacaagccggccaccttcaccatcgtcaccaaggatgctggggaagggggtctgtcc
ctggccgtcgaaggcccgtccaaggctgagatcacctgcaaggataacaaggatggcacc
tgcactgtctcctacctgcccacggcacccggggactacagcatcatcgttcgcttcgat
gacaagcacatccctggaagtcccttcactgccaagatcacaggcgatgactccatgcgc
acatcgcagctgaatgtgggcacttccacggatgtgtccctgaagatcacagagagtgac
ctgagcctgctgaccgccagcatccgcgccccttcgggcaacgaggaaccatgcctgctc
aagcggctgcccaaccggcatattgggatctcattcacacccaaggaggtgggtgagcac
gtggtgagcgtgcgcaagagtggcaagcacgtcaccaacagccccttcaagatcttcgtg
ggaccctcagagattggagacgccagcaaagtgcgggtctggggcaagggcctttctgag
ggtcacaccttccaggtgtccgagttcatcgtggacacccgcactgcaggatatggtggc
ctggggctgagcatcgaggggcccagcaaggtggacatcaactgtgaggacatggaggac
ggtacttgcaaagtcacctactgccccaccgagccgggcaactacatcatcaacatcaag
ttcgcggacaaacacgtgcccgggagcccgttcacagtgaaggtgacaggggaagggcgc
atgaaggagagcatcacccggcgccggcaggccccctccatcgccaccattggcagcacc
tgcgacctcaacctcaagatcccagggaactggttccagatggtgtcggctcaggagcgg
ctgacccggacgttcacgcggagcagccacacatacacacgcacggagcggacggagatc
agcaaaacccgaggcggggagaccaagagggaggtgcgggtggaggagtccacgcaggtc
gggggcgaccccttcccagctgtcttcggagacttcctgggccgcgagcggctcggctcc
ttcgggagcatcacccggcagcaggagggtgagaccgggtcccaggacatgaccgcgcag
gtgacgagcccatccgggaagacggaggaggccgagatcctggagggcgaggacagcgcc
tacagcgtgcgctttgtgccccaggagatggggccgcacacagtcaccgtcaagtaccgg
ggccagcatgtgccgggcagccctttccagttcaccgtggggccgctgggcgagggcggg
gcccacaaagtgcgggccgggggcaccgggctggaacgtggtgtggctggcgtgccagcg
gagttcagcatctggacccgagaagcgggggccggaggcctgtccatcgcagtagaaggg
cccagcaaggctgagatcgcatttgaggaccgcaaggatgggtcttgcggagtctcctat
gtcgtccaggagccaggggactatgaggtctctatcaaattcaacgatgagcacatcccc
gacagccccttcgtagtgcccgtggcctccctgtcggacgatgcccgccgcctcacagtc
accagcctccaggagacggggctgaaggtgaaccagccagcatccttcgcagtgcagctg
aacggggcccggggcgtgatcgacgccagagtgcacactccctcaggggccgtggaggaa
tgctacgtctccgagctggacagtgacaagcacacgatccgcttcattccccacgagaac
ggcgtccactccatcgacgtcaagttcaacggctcacacatcccagggagccccttcaaa
atccgggttggggagcagagccaggctggagaccctggactcgtctctgcctacggacca
ggcctagaaggaggcaccactggcgtgtcatcagaattcatcgttaacacagtgaatgca
ggctcaggggcactctcggtcaccatcgacggcccctccaaggtgcaactggactgccgc
gagtgtccggagggtcacgtggtcacctacacccccatggcccccggcagctacctcatc
gccatcaagtacggtggcccccagcacatcgtgggcagccccttcaaggccaaggtcaca
ggacccaggctgtcaggtggccacagcctccacgagacttccaccgtgctggtggagacg
gtgaccaagtcctcctccagccgtggctccagctacagttccatccccaagttctcctct
gacgccagcaaggtggtgaccaggggtcccgggctggccaaggccttcgtgggccagaag
aactccttcaccgtggactgcagcaaagcagccaagaccgcgggacacgcctgcccccga
attggagatgcccatgccccccaggactgtaacttgccccctcccaccccccacccccac
tctcctggggccgacgacctggagaagcagataaaggacacagacgtttag

DBGET integrated database retrieval system