KEGG   Ornithorhynchus anatinus (platypus): 100078341Help
Entry
100078341         CDS       T01045                                 

Gene name
PFN4
Definition
profilin family, member 4
Orthology
K05759  
profilin
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100078341 (PFN4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100078341 (PFN4)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100078341 (PFN4)
Exosome [BR:oaa04147]
 Exosomal proteins
  Proteins found in most exosomes
   100078341 (PFN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 138 aa AA seqDB search
MAANQKRGPLTQIQNLLIDSLLGTKHVENAAIIKLQDQSVWVASPGFNVSAQDAYMLISA
IASRSVQVRREGLYFTEKDYKCVRADEYSLYAKRDDEGVVVAKTDRYLVVGTYNQFMYPS
VCVEAVEKLADYFKKKKN
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaaatcagaagagagggccgttgactcagatccagaacttgctgatcgactcc
ctgctggggaccaagcacgtggagaacgcagccatcatcaaactccaggaccagtccgtg
tgggtagcatcccccggttttaatgtgtccgcccaggatgcttacatgctcattagtgcc
atcgcttccaggtcggtgcaggtacgaagggaagggctttacttcacagagaaggactat
aaatgcgtccgagcggatgagtattccctgtatgccaaaagggatgacgaaggtgtggtg
gtcgcaaaaacggacaggtaccttgtggtgggtacttacaatcagttcatgtatcccagc
gtctgtgtggaagccgtggagaaattggctgactattttaagaaaaagaaaaattaa

DBGET integrated database retrieval system