KEGG   Ornithorhynchus anatinus (platypus): 100078344Help
Entry
100078344         CDS       T01045                                 

Gene name
EGR3
Definition
early growth response 3
Orthology
K12497  
early growth response protein 3
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Hepatitis B
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100078344 (EGR3)
  Infectious diseases
   05161 Hepatitis B
    100078344 (EGR3)
Transcription factors [BR:oaa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    100078344 (EGR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 291 aa AA seqDB search
PPASSGALSTQTSTASLVQPPPGDGEPLYPPALPPYSSCGDLYPEPVAFHDPQGNPGLAY
SPQDYQSAKPALDANLFPMIPDYNLYHHPGEMSSMPEHKPFQALDPIRVNPPPITPLETI
KAFKDKQAHPAFGGLPPPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDE
LTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRH
AKIHLKQKEKKADKGGPASSSSSSSSAAAAAAAAAAAAGPLSLAPVVTTCA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
cccccggcctcctcgggggcgctcagcacgcagacctcgaccgccagcctggtgcagccg
cccccgggcgacggggagcccctctacccgccggccctgcccccctactccagctgcggc
gacctgtacccggagcccgtggctttccacgacccgcagggcaacccgggcctggcctac
tccccgcaggattaccagtcggccaagccggccttggacgccaacctcttccccatgatc
cccgactacaacctctatcaccacccgggcgagatgagctccatgccggagcacaagccc
ttccaggccctggaccccatccgggtcaacccgccgcccatcacgcccctggagaccatc
aaggccttcaaggacaagcaggcccacccggccttcgggggcctgcccccgccgcccctg
accctgaagcccatccggccccgcaagtaccccaaccggcccagcaagaccccgctccac
gagcggccccacgcctgtccggccgagggctgcgaccgccgcttcagccgctcggacgag
ctgacccggcacctgcgcatccacaccggccacaagcccttccagtgccgcatctgcatg
cgcagcttcagccgcagcgaccacttgaccacccacatccgcacccacacgggcgagaag
cccttcgcctgcgagttctgcggacgcaagtttgcgcgcagcgacgagcgcaagcgccac
gccaagatccacctcaaacagaaggagaagaaggccgacaagggcggcccggcctcctcc
tcttcctcctcctcctccgccgccgccgccgccgccgccgccgccgccgccgccggtccc
ctgtcgctggcccccgtggtcaccacttgcgcctga

DBGET integrated database retrieval system