KEGG   Ornithorhynchus anatinus (platypus): 100078344Help
Entry
100078344         CDS       T01045                                 

Definition
early growth response protein 3-like
Orthology
K12497  
early growth response protein 3
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Hepatitis B
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:oaa05203]
Human Diseases; Infectious diseases; Hepatitis B [PATH:oaa05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 291 aa AA seqDB search
PPASSGALSTQTSTASLVQPPPGDGEPLYPPALPPYSSCGDLYPEPVAFHDPQGNPGLAY
SPQDYQSAKPALDANLFPMIPDYNLYHHPGEMSSMPEHKPFQALDPIRVNPPPITPLETI
KAFKDKQAHPAFGGLPPPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDE
LTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRH
AKIHLKQKEKKADKGGPASSSSSSSSAAAAAAAAAAAAGPLSLAPVVTTCA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
cccccggcctcctcgggggcgctcagcacgcagacctcgaccgccagcctggtgcagccg
cccccgggcgacggggagcccctctacccgccggccctgcccccctactccagctgcggc
gacctgtacccggagcccgtggctttccacgacccgcagggcaacccgggcctggcctac
tccccgcaggattaccagtcggccaagccggccttggacgccaacctcttccccatgatc
cccgactacaacctctatcaccacccgggcgagatgagctccatgccggagcacaagccc
ttccaggccctggaccccatccgggtcaacccgccgcccatcacgcccctggagaccatc
aaggccttcaaggacaagcaggcccacccggccttcgggggcctgcccccgccgcccctg
accctgaagcccatccggccccgcaagtaccccaaccggcccagcaagaccccgctccac
gagcggccccacgcctgtccggccgagggctgcgaccgccgcttcagccgctcggacgag
ctgacccggcacctgcgcatccacaccggccacaagcccttccagtgccgcatctgcatg
cgcagcttcagccgcagcgaccacttgaccacccacatccgcacccacacgggcgagaag
cccttcgcctgcgagttctgcggacgcaagtttgcgcgcagcgacgagcgcaagcgccac
gccaagatccacctcaaacagaaggagaagaaggccgacaagggcggcccggcctcctcc
tcttcctcctcctcctccgccgccgccgccgccgccgccgccgccgccgccgccggtccc
ctgtcgctggcccccgtggtcaccacttgcgcctga

DBGET integrated database retrieval system