KEGG   Ornithorhynchus anatinus (platypus): 100078394Help
Entry
100078394         CDS       T01045                                 

Gene name
MAP2K6
Definition
mitogen-activated protein kinase kinase 6
Orthology
K04433  
mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
Influenza A
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100078394 (MAP2K6)
   04010 MAPK signaling pathway
    100078394 (MAP2K6)
   04668 TNF signaling pathway
    100078394 (MAP2K6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100078394 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    100078394 (MAP2K6)
  Endocrine system
   04912 GnRH signaling pathway
    100078394 (MAP2K6)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100078394 (MAP2K6)
  Development
   04380 Osteoclast differentiation
    100078394 (MAP2K6)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100078394 (MAP2K6)
  Infectious diseases
   05164 Influenza A
    100078394 (MAP2K6)
   05169 Epstein-Barr virus infection
    100078394 (MAP2K6)
   05145 Toxoplasmosis
    100078394 (MAP2K6)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100078394 (MAP2K6)
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100078394 (MAP2K6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 327 aa AA seqDB search
MSHLLGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGDKNFEVKADDLEPIAELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCHFTVTFYGALF
REGDVWICMELMDTSLDKFYKHVIDKGLTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINTLGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAIELAILRFPYDSWGTPFQQ
LKQVVEEPSPQLPVGKFSADFVDFTSQWQFFLSVFPKGQKSIFSVSFIEAGLASLRETFP
PGQHLFFTLHESKETDVASFVKLILGD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatcttctaggcaagaagcgaaacccagggctgaaaattcccaaagaagcattt
gagcaacctcagaccagctccacgccaccgcgggatttggactccaaagcctgcatctca
attggggataagaatttcgaagtgaaagctgacgacctggagcctatagcagaactggga
cgaggtgcgtacggggtagtggagaagatgcgacacgtgcctagcgggcagatcatggcg
gtgaagcgaatccgggcgacagtgaacagtcaggagcagaagaggctcctgatggatctg
gacatctccatgaggacggtggattgtcatttcacggtcaccttctatggtgcgctcttc
cgggagggcgatgtgtggatctgcatggaacttatggacacgtccctggataaattctat
aagcacgtcattgacaaaggtctgacaattcccgaggacatcttgggaaaaatcgcagtc
tcgatcgtaaaggcactagaacacctacacagtaagctctctgtcattcaccgagatgtc
aagccgtcgaacgtgttgatcaataccctgggccaagtgaagatgtgtgactttggaatc
agcggttacctcgtagactctgttgctaaaactatggacgcaggatgcaagccttacatg
gccatcgaactggccatcctgcggttcccctacgattcctggggcaccccgttccagcag
ctcaaacaggtggtggaagagccgtcaccccagcttcccgtgggcaagttctcagcagac
ttcgttgactttacctcacagtggcagttcttcctgtctgttttccccaagggacaaaaa
tcgatattttctgtttctttcatcgaagcaggtttggcctcgctccgtgaaactttcccc
cctgggcaacatctttttttcactctacatgaatccaaagagacagatgtggcatctttt
gtaaaactgattcttggagactaa

DBGET integrated database retrieval system