KEGG   Ornithorhynchus anatinus (platypus): 100078394Help
Entry
100078394         CDS       T01045                                 

Gene name
MAP2K6
Definition
(RefSeq) mitogen-activated protein kinase kinase 6
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04010  MAPK signaling pathway
oaa04015  Rap1 signaling pathway
oaa04218  Cellular senescence
oaa04380  Osteoclast differentiation
oaa04620  Toll-like receptor signaling pathway
oaa04664  Fc epsilon RI signaling pathway
oaa04668  TNF signaling pathway
oaa04750  Inflammatory mediator regulation of TRP channels
oaa04912  GnRH signaling pathway
oaa05014  Amyotrophic lateral sclerosis (ALS)
oaa05145  Toxoplasmosis
oaa05164  Influenza A
oaa05167  Kaposi's sarcoma-associated herpesvirus infection
oaa05169  Epstein-Barr virus infection
oaa05418  Fluid shear stress and atherosclerosis
Module
oaa_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100078394 (MAP2K6)
   04010 MAPK signaling pathway
    100078394 (MAP2K6)
   04668 TNF signaling pathway
    100078394 (MAP2K6)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100078394 (MAP2K6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100078394 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    100078394 (MAP2K6)
  Endocrine system
   04912 GnRH signaling pathway
    100078394 (MAP2K6)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100078394 (MAP2K6)
  Development
   04380 Osteoclast differentiation
    100078394 (MAP2K6)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100078394 (MAP2K6)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100078394 (MAP2K6)
  Infectious diseases
   05164 Influenza A
    100078394 (MAP2K6)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100078394 (MAP2K6)
   05169 Epstein-Barr virus infection
    100078394 (MAP2K6)
   05145 Toxoplasmosis
    100078394 (MAP2K6)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100078394 (MAP2K6)
Protein kinases [BR:oaa01001]
 Serine/threonine kinases: STE group
  STE7 family
   100078394 (MAP2K6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Seadorna_VP7 Haspin_kinase DUF4344 Choline_kinase APH
Motif
Other DBs
NCBI-GeneID: 100078394
NCBI-ProteinID: XP_001509445
Position
Un
AA seq 327 aa AA seqDB search
MSHLLGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGDKNFEVKADDLEPIAELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCHFTVTFYGALF
REGDVWICMELMDTSLDKFYKHVIDKGLTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINTLGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAIELAILRFPYDSWGTPFQQ
LKQVVEEPSPQLPVGKFSADFVDFTSQWQFFLSVFPKGQKSIFSVSFIEAGLASLRETFP
PGQHLFFTLHESKETDVASFVKLILGD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatcttctaggcaagaagcgaaacccagggctgaaaattcccaaagaagcattt
gagcaacctcagaccagctccacgccaccgcgggatttggactccaaagcctgcatctca
attggggataagaatttcgaagtgaaagctgacgacctggagcctatagcagaactggga
cgaggtgcgtacggggtagtggagaagatgcgacacgtgcctagcgggcagatcatggcg
gtgaagcgaatccgggcgacagtgaacagtcaggagcagaagaggctcctgatggatctg
gacatctccatgaggacggtggattgtcatttcacggtcaccttctatggtgcgctcttc
cgggagggcgatgtgtggatctgcatggaacttatggacacgtccctggataaattctat
aagcacgtcattgacaaaggtctgacaattcccgaggacatcttgggaaaaatcgcagtc
tcgatcgtaaaggcactagaacacctacacagtaagctctctgtcattcaccgagatgtc
aagccgtcgaacgtgttgatcaataccctgggccaagtgaagatgtgtgactttggaatc
agcggttacctcgtagactctgttgctaaaactatggacgcaggatgcaagccttacatg
gccatcgaactggccatcctgcggttcccctacgattcctggggcaccccgttccagcag
ctcaaacaggtggtggaagagccgtcaccccagcttcccgtgggcaagttctcagcagac
ttcgttgactttacctcacagtggcagttcttcctgtctgttttccccaagggacaaaaa
tcgatattttctgtttctttcatcgaagcaggtttggcctcgctccgtgaaactttcccc
cctgggcaacatctttttttcactctacatgaatccaaagagacagatgtggcatctttt
gtaaaactgattcttggagactaa

DBGET integrated database retrieval system