KEGG   Ornithorhynchus anatinus (platypus): 100078422Help
Entry
100078422         CDS       T01045                                 

Gene name
GRIA4
Definition
(RefSeq) glutamate ionotropic receptor AMPA type subunit 4
  KO
K05200  glutamate receptor 4
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04024  cAMP signaling pathway
oaa04080  Neuroactive ligand-receptor interaction
oaa04713  Circadian entrainment
oaa04723  Retrograde endocannabinoid signaling
oaa04724  Glutamatergic synapse
oaa04728  Dopaminergic synapse
oaa05031  Amphetamine addiction
oaa05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    100078422 (GRIA4)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100078422 (GRIA4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    100078422 (GRIA4)
   04728 Dopaminergic synapse
    100078422 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    100078422 (GRIA4)
  Environmental adaptation
   04713 Circadian entrainment
    100078422 (GRIA4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    100078422 (GRIA4)
   05033 Nicotine addiction
    100078422 (GRIA4)
Ion channels [BR:oaa04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   100078422 (GRIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 100078422
NCBI-ProteinID: XP_007665050
Position
Un
AA seq 1050 aa AA seqDB search
MHPFITSEWAFLTVFVGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIET
ANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQ
LRPSLRGALLSLLDHYEWNRFVFLYDTDRAVYGKCNGNSKSFQVNTFMPLKISSECKLVH
KVLVSISHNLKRNHGSKVFSYSFVHWSQLSGRRYSLGPRTFRSDGDVKSACLPNCLKALD
DFKKLGFKNVFVEVECPCSLRVNSTGPSNQLRYESETTRRHLITTARAKSDFPTGWWPKL
IFDPRHQRDRITEDTKADGGLRNDTGYHSLRSEIANEKSDLLIMRSHTFGHKATLNLCLR
KVAGKRGLLNFQIVSVGKHVKGYHYIVANLGFKDISLERFMHGGANVTGFQLVDFSTPMV
SKLMQRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRNLRRQKIDISRRGNAGDCL
ANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKNTGPRKVGYWND
MDKLVLIQDVPTLGNDTAAVENRTVVVTTIMESPYVMFKKNHEMFEGNDKYEGYCVDLAS
EIAKHIGIKYKIAIVPDGKYGARDAETKIWNGMVGELVYGKAEIAIAPLTITLVREEVID
FSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE
WHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTL
IIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKM
WTYMKSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSK
GYGVATPKGSPLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLS
NVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKLTFSEAIRNKARLSITGSVGENGR
VLTPDCPKAIHAGTAIRQSSGLAVIASDLP
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atgcacccctttattacgagtgaatgggcttttctcactgtttttgtaggtggtctcttc
atcaggaacacagatcaggaatataccgcttttcgattagcaatttttcttcataacacc
agccccaatgcttcggaagcaccttttaatttggttcctcatgtggacaacattgagaca
gccaacagcttcgctgtaacaaatgccttctgctcccagtattctcgaggagtttttgcc
atttttggattatacgataagaggtcggtccacaccctgacctcgttttgcagcgccttg
cacatctccctcatcacgccgagcttccccaccgaaggggagagtcaattcgtgctgcag
ttgagaccctctctccgaggagcgctcctgagcctgttggatcactacgaatggaaccgc
ttcgtctttctgtacgacacggacagggctgtgtatggaaaatgtaatggaaactctaaa
tcttttcaagtgaacaccttcatgcccctgaaaatatcatcagagtgtaaactggtgcac
aaagtcttggtcagcatcagtcataacttaaaaagaaaccacggttcaaaggtgttttcc
tacagcttcgtccactggtcccagcttagtggaagacgatattctctcgggccacggact
ttccgctccgatggagatgtaaaaagcgcgtgtttaccaaattgcctgaaagcacttgat
gatttcaaaaaattgggcttcaagaacgtattcgtagaagttgaatgtccttgctcgctt
cgagtgaactcaactggccccagtaaccagttgcgctatgaatcggaaacgacgcgacgg
catttgataacaacagccagggccaaatcagatttcccaacaggatggtggccaaagttg
atatttgatccacggcaccaacgggaccgaataacagaagataccaaagcggacggaggt
ttacggaatgacactggataccattcattgagatctgaaatagcaaatgaaaagtctgat
ctcctgattatgagaagccatacgtttggtcacaaggcgaccttaaatctctgcttgagg
aaagtggctggaaaaaggggtcttcttaattttcagattgtgagtgttggaaagcatgtt
aaaggctaccattacattgtggcaaacctgggattcaaggatatttctctggagaggttt
atgcacggaggagccaacgtaacgggatttcagttagtagatttcagtactcctatggta
agcaaactcatgcagcgctggaaaaaactggaccagagagagtaccctggatcggaaact
cctccaaagtacacatcggctctgacttacgatggggttcttgtgatggcggaaactttt
cgcaatctcagacgacagaaaattgacatttcaagacgagggaatgcaggagattgcctg
gcaaatcccgctgccccttgggggcaagggattgatatggagaggaccctcaaacaggtt
cgaattcaaggattgaccggcaatgttcagtttgaccactatggacgtagagtcaactac
acaatggatgtgtttgagctgaagaacacaggccctagaaaggttggttactggaatgat
atggataagctcgtcttgattcaggatgtacccacactcggcaacgataccgcggccgtc
gagaaccgaacagtagttgtaaccacaattatggaatctccatatgttatgttcaagaaa
aaccatgaaatgtttgaagggaatgacaagtatgaaggctactgtgtagatcttgcatct
gaaattgcaaaacatatcggtatcaagtacaaaattgccattgttcccgatggaaaatac
ggagcaagggatgcagagacaaagatttggaatgggatggtgggagaactcgtttacggg
aaagcagagatcgccattgcccctctgacaatcactttggtccgtgaagaggtcattgac
ttttccaaaccttttatgagtttgggtatatccattatgatcaaaaaaccccagaaatct
aaaccaggtgtcttctccttcctggatcctttggcctacgagatctggatgtgcatagtt
tttgcctatattggggtcagcgtggtgctgtttctggttagccgctttagcccctatgaa
tggcacacagaagagccagaggatggaaaggaaggaccaagcgaccagcctcctaatgag
tttggcatttttaacagcctctggttttccctgggtgccttcatgcaacaaggatgtgac
atttcgccaagatccctctcaggtcgtatcgttggaggtgtatggtggttctttacgctc
atcatcatctcatcgtacaccgctaacctcgctgctttcttgactgttgagagaatggtc
tccccaatagaaagtgctgaagatctggccaaacaaactgaaattgcatatggaacactg
gactcaggctcaacaaaagaattcttcagaagatccaaaatagcagtgtacgaaaagatg
tggacctacatgaaatccgcagagccatccgtgttcacgaggactacagccgagggagta
gctcgggtccgcaaatccaagggcaaatttgccttcctcctggagtccactatgaatgaa
tacattgagcagcgaaagccgtgtgacaccatgaaagtgggaggaaatctggattcgaaa
ggctatggagtagcaacgcccaagggttccccattaagaaatgctgttaacctcgcagtt
ttaaaactgaatgaacaaggcctgttggacaaattgaaaaacaaatggtggtacgacaaa
ggagaatgtggcagcgggggaggtgactccaaggacaagacgagtgccttgagtctgagc
aacgtagctggagtcttctacattctggttggaggcttgggcttggcaatgctggtggct
ttgatagaattctgttacaagtccagggcagaagcaaagcgaatgaagctgaccttttcc
gaagccataagaaacaaagccagattatccatcaccggaagcgtcggagaaaacggccgg
gtattgactcctgattgcccaaaggccatccacgccggaactgcaattagacagagttca
ggattggcggtaattgcatcggacctaccataa

DBGET integrated database retrieval system