KEGG   Ornithorhynchus anatinus (platypus): 100078507Help
Entry
100078507         CDS       T01045                                 

Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01522  Endocrine resistance
oaa04010  MAPK signaling pathway
oaa04015  Rap1 signaling pathway
oaa04068  FoxO signaling pathway
oaa04071  Sphingolipid signaling pathway
oaa04218  Cellular senescence
oaa04261  Adrenergic signaling in cardiomyocytes
oaa04370  VEGF signaling pathway
oaa04380  Osteoclast differentiation
oaa04550  Signaling pathways regulating pluripotency of stem cells
oaa04611  Platelet activation
oaa04620  Toll-like receptor signaling pathway
oaa04621  NOD-like receptor signaling pathway
oaa04622  RIG-I-like receptor signaling pathway
oaa04625  C-type lectin receptor signaling pathway
oaa04657  IL-17 signaling pathway
oaa04658  Th1 and Th2 cell differentiation
oaa04659  Th17 cell differentiation
oaa04660  T cell receptor signaling pathway
oaa04664  Fc epsilon RI signaling pathway
oaa04668  TNF signaling pathway
oaa04670  Leukocyte transendothelial migration
oaa04714  Thermogenesis
oaa04722  Neurotrophin signaling pathway
oaa04723  Retrograde endocannabinoid signaling
oaa04728  Dopaminergic synapse
oaa04750  Inflammatory mediator regulation of TRP channels
oaa04912  GnRH signaling pathway
oaa04914  Progesterone-mediated oocyte maturation
oaa04917  Prolactin signaling pathway
oaa04926  Relaxin signaling pathway
oaa04933  AGE-RAGE signaling pathway in diabetic complications
oaa05014  Amyotrophic lateral sclerosis (ALS)
oaa05132  Salmonella infection
oaa05133  Pertussis
oaa05140  Leishmaniasis
oaa05142  Chagas disease (American trypanosomiasis)
oaa05145  Toxoplasmosis
oaa05152  Tuberculosis
oaa05160  Hepatitis C
oaa05164  Influenza A
oaa05167  Kaposi's sarcoma-associated herpesvirus infection
oaa05169  Epstein-Barr virus infection
oaa05205  Proteoglycans in cancer
oaa05418  Fluid shear stress and atherosclerosis
Module
oaa_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100078507
   04010 MAPK signaling pathway
    100078507
   04370 VEGF signaling pathway
    100078507
   04668 TNF signaling pathway
    100078507
   04068 FoxO signaling pathway
    100078507
   04071 Sphingolipid signaling pathway
    100078507
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100078507
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100078507
 Organismal Systems
  Immune system
   04611 Platelet activation
    100078507
   04620 Toll-like receptor signaling pathway
    100078507
   04621 NOD-like receptor signaling pathway
    100078507
   04622 RIG-I-like receptor signaling pathway
    100078507
   04625 C-type lectin receptor signaling pathway
    100078507
   04660 T cell receptor signaling pathway
    100078507
   04658 Th1 and Th2 cell differentiation
    100078507
   04659 Th17 cell differentiation
    100078507
   04657 IL-17 signaling pathway
    100078507
   04664 Fc epsilon RI signaling pathway
    100078507
   04670 Leukocyte transendothelial migration
    100078507
  Endocrine system
   04912 GnRH signaling pathway
    100078507
   04914 Progesterone-mediated oocyte maturation
    100078507
   04917 Prolactin signaling pathway
    100078507
   04926 Relaxin signaling pathway
    100078507
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100078507
  Nervous system
   04728 Dopaminergic synapse
    100078507
   04723 Retrograde endocannabinoid signaling
    100078507
   04722 Neurotrophin signaling pathway
    100078507
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100078507
  Development
   04380 Osteoclast differentiation
    100078507
  Environmental adaptation
   04714 Thermogenesis
    100078507
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100078507
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100078507
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100078507
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100078507
  Infectious diseases
   05132 Salmonella infection
    100078507
   05133 Pertussis
    100078507
   05152 Tuberculosis
    100078507
   05164 Influenza A
    100078507
   05160 Hepatitis C
    100078507
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100078507
   05169 Epstein-Barr virus infection
    100078507
   05145 Toxoplasmosis
    100078507
   05140 Leishmaniasis
    100078507
   05142 Chagas disease (American trypanosomiasis)
    100078507
  Drug resistance
   01522 Endocrine resistance
    100078507
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100078507
Protein kinases [BR:oaa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100078507
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH RIO1 Kinase-like Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100078507
NCBI-ProteinID: XP_001509537
Position
Un
AA seq 374 aa AA seqDB search
MNSGRRKGFIRQEVNKTAWDLPMVYGPLTPVGSGAYGSVCSAINSKTGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTSATSLHNFQDFYLVMPFMQTDLQKIMGM
EFSEDKIQYLVYQMLKGLKYIHSAGVIHRDLKPGNLAVNEDCELKILDFGLARHADSEMT
GYVVTRWYRAPEVILSWMHYNKTVDIWSVGCIMAEMITGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLQDKAAKSYIQALPRSPKKDFSQLFPQASPQAADLLEKMLELDVEKRLTAT
QALAHPFFDQFRDPEEETEAQHPFDDSLEHEKLTVEEWKSHIYKEITSFSPIVRNDSKRR
SGMKLATSPASSGT
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgggccggaggaagggctttatccggcaggaagtgaacaagacggcctgggac
ctgcccatggtctacgggcccctgacccccgtgggcagcggcgcctacggctccgtgtgc
tcagctatcaattcgaagaccggggagaaggtggctatcaagaaactgagccgaccattc
cagtccgagatcttcgccaagagggcctatcgggagctgctgctgctgaagcacatgcag
catgagaatgtgattgggctgctggatgtcttcacctcggccacttcgctacacaacttt
caggatttctacctggtgatgcccttcatgcagactgacctgcagaagatcatggggatg
gagttcagtgaggacaagatccagtaccttgtctaccagatgctgaaagggcttaagtac
atccactcggctggggtcattcacagggacctgaagccgggaaacttggctgtgaatgag
gactgtgaactcaagatcctggattttgggctggcccggcacgcagactctgagatgacg
ggctacgtggtgacccgctggtaccgggctccagaggtgatcctcagctggatgcactac
aacaagacagtggacatctggtccgtcggctgcatcatggccgagatgataacggggaaa
acgctatttaagggaaaagactacctggaccagctgacccagatcctaaaagtgactggg
gttccgggagccgagtttgtgcagaagctgcaggacaaagcggccaaatcctacatccag
gccctgcctcggagtcccaagaaggatttctcgcagctcttcccccaggccagtccccaa
gcggccgaccttctggagaagatgctggagctggatgtggagaagcggctgaccgccacc
caggctctggcccaccctttctttgaccagttccgggatccggaggaggagacagaggcc
cagcacccatttgatgactccctggagcacgaaaagctcacagtggaggagtggaagagt
cacatctacaaggagatcacaagcttcagccccattgtccggaacgactccaagaggcgg
agcggcatgaaactagcgaccagcccagccagttctgggacttga

DBGET integrated database retrieval system