KEGG   Ornithorhynchus anatinus (platypus): 100078529Help
Entry
100078529         CDS       T01045                                 

Definition
phospholipase B1, membrane-associated-like
Orthology
K14621  
phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Vitamin digestion and absorption
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:oaa00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:oaa00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:oaa00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:oaa00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:oaa00592]
Organismal Systems; Digestive system; Vitamin digestion and absorption [PATH:oaa04977]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1534 aa AA seqDB search
MARGVGGPKGKTECIIVAILARPALLSPEGENEPLQYPADSKYPGSDSTTCQAPIYQPSP
NWTLMNPLQAFQTVVRVSKFVTVRCLVALLSRLLNSCKERDELHHSSSRKQPQLPRILVR
QGALQGRVLDLNEKGATRGVSRNGSLAGGRSPPTADIVMLDQGGHQLIKRICNLSLKNLQ
KDQEKPASLLNLLKCRPDFTRKQLSKGAGVAGAHTLRPSDIKVVAAIGSLEMSTDSGMDL
ENLQRVAAGGMSGASSPKPLPPHHSFLFENDRFLGTRLDQDSQLDFENDWKLITVFLSPQ
DACLPCSSNQQVKSSLVDPHARNVEEIQKVLDFLHKEVPKAFVNLVANPEFGGLSLPHRE
TEVRVDCKAFTPLSSHSTPPREPCACSKKPSRLERAVMRWSHQNYWEKLLASGRYDTEDS
FTVVLQPIFHDKDSSLFPGKQVHEDSTLNWNDNSEFAALALDLWNVMMEEVGQKEEPNHG
QGGHSAKCPTEPNFSQTEGLKGFVKLIEMVTPKAGVLLRCASLLFMLQEREGAEVLCPDK
TPSATVPTSVHRLKPADIKVIAALGDSLTAANGAGSRASDILDVLTQYRGLSWSVGGNEN
ISTVTTLANILREFNPSLQGFSIGTGKQTSPGAFLNQAVAGDLAEDLPAQARRLVDLMKN
SFKFNFQEDWKIITIFIGGNDLCDFCSDPVHYSPGNFTRNIEKALDILHAEVPRAFVNLV
PVLEIVSLRKLYQEKKVFCPRLLLRSLCPCVVKFADNSTEIASLILLNKRYQEGTHQLID
SGKYDTREDFTVVIQPFLEKVSMPMTPEGLPDSSFFAPDCFHFHKKAHGRAASGLWNNML
EPLGKKKTEQNFEKLINITCPTQARPFLSTYRNSNYTYPNHFSSTPPPPTSTPADQGHGS
QLQCEDKAPSASLPKSVHTLKPADVKVVAAIGDSLTAGTGICSKAGDLENITTQYRGLSY
SAGGDATLGSVTTLPNILREFNGDLTGYAIGVGEASDHNAFLNQAVPGAKAEGLLSQVQA
LVQRMKDNPRVSFQRDWKIITVLIGIHDLCDYCTDSNLYSATNFVGHLQAALDMLHREVP
RALVNLVEVRNLTLLRRVFLDDRVNCPIQLASYLCNCVLTVREGSPELARIEEVTRAYQS
GTRRLVESGRYDTREDFTVVLQPFFQDIKLAFLPDGRPDISFFAPNCFHPSQKFHSQLSR
ALWNNMLQPLGRKTDSLDLAADVPLSCPTVSEPFLATYKNSNYTYPPGPPIQNWGSDLLC
PERSPSSQIPTSVHKLRPADIKVVAALGDSLTTAVGACASNFSDLTTAWRGLSWSIGGDG
TLETHTTLPNILKKFNPQIYGYSIGTEEGTAGFNVAVGGAKAQDMPVQARALVERMKHSL
EVNLEQDWKLITLFVGGNDLCVYCKDEDTHSVEKYVQHLEQALDILSELPRVFVSVVEIM
EMVGLRQIHGEKCLVPVQNFCPCFLLPQENSPELQEMKNVNRAFQRPDLRGHCNNRNEYP
PLSLLHLQPIFMSLLLSHWILFPVASGPSASNPS
NT seq 4605 nt NT seq  +upstreamnt  +downstreamnt
atggccaggggtgtgggtggtcccaaggggaaaacagagtgcatcattgtggcaatcctg
gccaggccagccctcctctcacctgaaggagagaatgagccactccagtacccagctgac
tccaagtacccaggatccgactccactacctgtcaggcccccatttaccagccgtcccca
aactggaccctaatgaatcctttgcaggcctttcagacggtagtcagagtgtccaaattt
gtgactgtccggtgtctggtcgcattactcagccggctcctgaactcatgcaaggaaaga
gatgagttacaccactctagttcaagaaaacagcctcagctcccgcgcattctggttcgg
caaggagccctgcaagggcgtgtgctggatcttaatgagaagggcgcgaccagaggcgtt
tctagaaacgggtcgctggctgggggcagatcacctcctacggcggatattgtgatgtta
gatcagggaggccatcagttaataaagagaatttgcaatttatccctgaagaacttgcaa
aaggaccaagagaaacctgcaagtttgctaaacctgctgaaatgcaggccagatttcacc
aggaaacaactctctaaaggagcaggagtggctggagcccacaccctgaggccttctgat
atcaaagtcgttgcagctattggaagtttggaaatgtccacagactcagggatggacttg
gagaatctgcaaagagtagcagcaggaggaatgtcgggggcgtcctcaccaaagccactg
cctcctcaccactcctttctctttgaaaatgaccggttcctggggaccaggctggaccaa
gactctcaactggactttgaaaatgactggaaacttatcacagtgttcctgagtccacag
gacgcgtgtcttccttgttcttcaaaccaacaggtaaagagcagcctggtggatccccat
gccagaaacgtggaagaaattcaaaaggtcctggactttttgcataaagaggtccccaaa
gcctttgtgaaccttgtggccaacccagagtttgggggcttgtccctccctcatcgggaa
actgaagtcagggttgactgcaaggctttcacaccactatcttcccacagcactccacca
agggagccgtgcgcctgctcaaagaagccctccagactggaaagagctgtgatgagatgg
tcccaccagaactattgggaaaaactactggcctcaggcaggtacgacacagaagattcc
ttcacagtggttctccagcctatctttcatgacaaagactcgtctttgttcccggggaaa
caggttcacgaagactcaacgctcaactggaatgacaactcagagtttgcggctcttgct
ttggatctctggaacgtcatgatggaagaagtaggacagaaggaggagccaaatcatggc
caaggaggtcactcagccaaatgtcccaccgagcctaatttctcccagaccgagggccta
aaggggtttgtaaagttgattgaaatggtgactcctaaggcaggagttctcctgagatgt
gctagcctccttttcatgctccaggagagagaaggagcagaagtcctatgtccagacaag
actccctcggccactgtgcccacctcagttcataggctgaagcctgctgacattaaagtt
attgcagctctgggtgactcactcacggccgcaaacggggcaggatccagagccagtgat
atcctggatgtcttgacccagtaccgaggcctatcttggagtgtcggaggaaacgagaac
ataagcacagtcaccacattagcaaacattctcagggaattcaacccttccctgcagggc
ttctccattgggaccggaaagcaaacgagccctggcgccttcctgaaccaggcagtggcc
ggagaccttgccgaagacctgcccgctcaagctcggagattggtggacctaatgaagaat
tcttttaaattcaatttccaagaagattggaagataataaccatttttataggagggaat
gatctctgtgatttctgcagtgacccagtccactattctcctggtaactttacaagaaac
atagagaaggcattggacattcttcacgcagaggttcctcgggcctttgtgaatctagtc
ccagtgcttgagattgtttccctgaggaaactgtatcaggaaaagaaggtcttctgtcca
cggctgctgctcaggagtctgtgcccttgtgtggtgaagtttgctgacaattccacagaa
attgcctccctcatcctattaaataaacgttatcaggagggaacacaccaacttattgac
agcggaaagtacgacacgagggaagacttcacggtggtcatccaaccatttctggagaaa
gtttctatgcccatgacaccggagggcttgcccgacagctctttcttcgctcctgactgt
tttcacttccacaagaaggctcatggtcgggcagccagtggtctctggaacaacatgctg
gaacctcttggcaagaagaagactgaacagaattttgaaaagctaatcaatatcacatgc
ccgactcaggctcggcccttcctgagcacctaccgtaatagcaattacacatacccaaac
cacttcagttcaacgcctccccctcccaccagcacaccagcagaccagggtcatgggagc
caattgcagtgtgaggacaaagccccatctgcctctcttcccaaatcagtccataccctg
aaaccagcagacgtgaaagtcgttgcggccatcggagactctctgactgctggcaccgga
atttgctccaaagcaggcgaccttgagaatataactacccagtacagaggcctatcatac
agtgctggaggagatgccacactagggagtgtgaccacgttacctaatatcctacgggag
tttaacggggatctcacaggctacgccatcggtgtcggggaggccagtgatcacaacgct
ttcctcaaccaggctgttccgggtgcaaaagcagaggggctgctgagccaggtccaggcc
ttggtgcagagaatgaaagacaacccgagagtaagtttccagagagactggaaaatcatc
accgtgctcatcggcatccatgacttgtgtgactactgcactgactcgaatttgtattcc
gccaccaattttgttggacatctccaagctgccctggacatgctgcacagagaggttcct
cgagccctggtcaacctggtggaggtcaggaacctcacccttctgaggcgtgtgttccta
gatgaccgagttaattgtccaatacagctggcaagctatctctgtaactgtgtcctgact
gtcagagaaggctctccagaactggccaggatagaagaagtcacaagggcctaccagagt
ggcacccgccggttggtggagtcgggccgatatgacacccgggaggatttcacggtggtg
ctgcagcctttcttccaggacatcaagcttgcctttcttccggatggtcgcccagatatt
tccttcttcgcacccaattgcttccacccaagccagaaattccactcccaactctcccga
gccctctggaacaacatgcttcagccattaggaaggaagacagattccctggatttggca
gctgatgttcccctgtcctgcccaactgtgtcagaacccttcctggcaacatacaagaac
agtaactacacatatccgcctggcccacccattcagaactgggggagtgatttgctgtgt
cctgagaggagtccatcatcccagatccccacatcagtccacaagctccggccagcagac
atcaaggtggtggcagctcttggagattctctgactacagctgtaggagcttgtgccagc
aacttcagtgacctaaccacagcatggagaggactctcatggagtatcggaggagacgga
accctggagactcataccacattgcccaatattttaaagaaatttaatcctcaaatctat
ggatattccattggaacggaggagggaacagctggatttaatgtagcagttggaggggcc
aaggcacaggatatgccagtgcaggcccgagccctggtggaacgaatgaagcacagcctg
gaagtcaacctggaacaagactggaagctgatcacgttgtttgtcggtggcaatgacctg
tgtgtgtactgcaaggacgaggatactcactcagtggaaaaatatgtgcagcacctcgaa
caagctctggatattctctctgagctccctcgagtcttcgtcagtgttgtggagattatg
gagatggttggtcttcgacaaatacacggggaaaaatgcctggtgccggttcagaacttt
tgcccttgctttctactgccccaggagaattccccggagttacaagaaatgaagaatgta
aacagagctttccagcgaccagatctcagaggccactgcaataacaggaatgagtaccct
ccgctttccctgctccaccttcagccaatcttcatgtcactgctgctttctcactggatt
ctctttccggtggcctcaggaccctcagcatcaaatccctcctaa

DBGET integrated database retrieval system