KEGG   Ornithorhynchus anatinus (platypus): 100078536Help
Entry
100078536         CDS       T01045                                 

Definition
histone H3-like
Orthology
K11253  
histone H3
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Alcoholism
Transcriptional misregulation in cancer
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    100078536
  Immune diseases
   05322 Systemic lupus erythematosus
    100078536
  Substance dependence
   05034 Alcoholism
    100078536
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100078536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 140 aa AA seqDB search
ISTKKTLAHDKQTAHKITGGKASHKQLANKAARKNPPATGGEKKPHCYRPGIVALREIWR
YQKFGLIHKLPFHGLVSEIAQDFKTDLHFQSSAIMALQEVNEAYLMELFEDTNQCAIHAK
RVTIMPKDIQLACHIRGERA
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atttctaccaagaaaactctggctcatgataagcagactgcccataagatcaccggcggc
aaggcgtcccacaaacagctggccaacaaggctgcccgcaagaatcccccagctaccggc
ggcgagaagaagcctcactgctaccggcctggcatcgtggctctgcgggagatctggcgc
taccagaagtttgggctgatccacaaacttccctttcacgggctggtgagtgagatcgcc
caggacttcaagacagatctgcacttccagagctcggccattatggcactgcaggaggta
aatgaggcctacctgatggaactgttcgaggacaccaaccagtgcgccattcacgccaag
agggtcaccatcatgcccaaggacatccagcttgcctgccacatccgtggagagagagct
taa

DBGET integrated database retrieval system