KEGG   Ornithorhynchus anatinus (platypus): 100078541Help
Entry
100078541         CDS       T01045                                 

Gene name
ACACA
Definition
acetyl-CoA carboxylase alpha
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
AMPK signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100078541 (ACACA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100078541 (ACACA)
   00640 Propanoate metabolism
    100078541 (ACACA)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100078541 (ACACA)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100078541 (ACACA)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100078541 (ACACA)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100078541 (ACACA)
Enzymes [BR:oaa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100078541 (ACACA)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100078541 (ACACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1986 aa AA seqDB search
MDEPSTLTKPLDLNQHSRFIIGSVSEDNSEDEISSLVKLDLLEEKEGSLSPASVSSDTLS
DLGLSGLQDGPGLAVHMRPSMSGLHLVKQGRDRKKVDLQRDFTVASPAEFVTRFGGNKVI
EKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPV
PGGTNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMW
ALGDKIASSIVAQTAGIPTLPWSGSGLCVDWQENDFQKPILNVPQEVYEKGYVKDVDDGM
LAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHL
EVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATSVIFERMEQCAVKLAKMVGYV
SAGTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRM
MYGVSPWGDVPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVW
GYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLL
ETESFQQNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERG
QVLPAHTLLNTADVELIYEGAKYVLKNASLFLPPGHYDKCVFALREENKSDMNTVLNYIF
SHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASH
LPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAA
LEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLNHY
GMAHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFCDSPPQSPTFPEA
GHTSLYDEEKAARDEPIHILNVAIKTDCDIEDDGLAAIFREFTQCKKAVLIEHGIRRLTF
LVAQKDFRKQVNYEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQLELNRMRNF
DLTAIPCANHKMHLYLGAAKVEVGIEVTDYRFFVRAIIRHSDLVTKIEESVRSMVMRYGS
RLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAY
GDKQGPLHGMLINTPYVTKDLLQSKRFQAQTLGTTYIYDIPEMFRQSLLKLWESMAAQAF
LPSPPLPSDILTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTLKSPEYPEGRDIIVIG
NDITYRIGSFGPQEDILFLRASELARAQGIPRIYVAANSGARIGLAEEIRHMFHVAWVDP
ADPYKGYKYLYLTPQDYKKVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGSG
MIAGESSLAYDKIITISLVSCRAIGIGAYLVRLAQRTIQVENSHLILTGAAALNKVLGRE
VYTSNNQLGGIQIMHNNGVTHSTVCDDFEGVLTILHWLSYMPKNVYSPVPMLNSKDPIDR
IIEFVPTKAPYDPRWMLAGRPHPGQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGI
PVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLM
VFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECSQPVLVYIPPQAELRGGSWVVIDPTIN
PRHMEMYADRESRGSVLEPEGTVEIKFRKKDLVKTMRRVDPVYIHLAERLGTPELSPAER
KELEAKLKEREEFLTPIYHQVAVQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWRLRR
LLLEDLVKKKIHDANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQLNEE
EGARSVVDENIKYISRDYILKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTM
DSPPST
NT seq 5961 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaccatctactttgaccaagcccctggacctgaatcagcactctcgcttcata
attggctccgtgtccgaagataactcggaggacgagatcagctccttggtgaagctcgac
ttgctggaagaaaaggaggggtccctgtcgccggcttccgtctcctcggacaccctgtcc
gacctggggctctccggcctccaggatggccccggtctggctgtgcacatgaggcccagc
atgtctggcctacacctggtaaaacaaggccgcgatcgaaagaaagtagacctgcagcga
gatttcaccgtggcttctccagcagaatttgtgactcgttttggaggaaataaagttatc
gagaaggttctcatcgccaacaatggcatcgctgccgtgaaatgcatgcggtctatccgc
cggtggtcttatgagatgtttagaaatgagcgggccattagatttgtggtcatggtcaca
cccgaagatctgaaagccaacgcagagtacattaagatggcagaccactatgtgccggtg
ccagggggcacgaacaacaacaactatgcaaacgtggaacttattctcgatatcgcgaaa
aggattccggtgcaggcagtgtgggctggctggggtcacgcttccgagaatcccaagctt
ccagaactcctccttaaaaacggcattgcctttatgggtcctccaagccaagccatgtgg
gctctgggtgataaaatcgcttcctccattgtggcccagactgcaggcatccccactctt
ccctggagtggcagcggtctttgtgtcgactggcaggagaacgattttcagaaacccatc
ttgaacgttccccaggaggtgtatgaaaagggttatgtgaaggatgtggatgatgggatg
ctggcagctgaggaagttggatacccagtgatgatcaaggcttcagaaggaggaggggga
aaaggaatcagaaaagtcaacaatgcagatgacttccctaacctcttcagacaggttcaa
gctgaagtgcccggctcgcccatctttgtgatgagactggccaaacagtcccgtcatttg
gaagtgcagattctggccgatcagtacggcaacgccatctccctgttcggccgcgactgc
tctgtgcagcgcaggcaccagaagatcatcgaagaggcgcccgccaccatcgcgacctct
gtcattttcgagcgcatggagcagtgtgccgtgaagctggccaagatggttggctacgtg
agcgcgggcacggtggagtacctctacagccaagacggcagcttttacttcctggaattg
aatccccggctccaggtggaacacccctgcacggagatggtagccgacgtcaatctgcct
gccgcccagctccagatcgccatgggaattcctctgtaccgaatcaaggacatacgcatg
atgtacggggtgtccccctggggagacgtccccattgattttgagaactccgcccacgtc
ccgtgcccccggggccacgtcatcgccgcgcggatcaccagtgagaatccagacgagggt
tttaaacccagttcaggaacagtccaggaactgaacttccgcagtaataagaacgtgtgg
ggatattttagcgtggcggccgccgggggacttcacgagtttgcagattctcagtttggc
cactgcttctcctggggagagaacagagaggaagcaatttcaaacatggtggtggccctg
aaggagctgtccatccgaggggacttccgaaccacggtcgagtacctcatcaaactgttg
gagacggagagcttccagcagaacagaatcgataccggctggttggacaggctgatagcc
gagaaggtccaggcggagcggcccgacaccatgttgggggtagtgtgcggagccctgcac
gtagccgacgtgagcctgcggaacagcgtctccaacttcctgcattccctggagaggggc
caagtactgcccgctcatacgcttctgaacacagcagacgtagagctgatctatgaaggg
gccaagtatgtattgaagaatgcttctttattccttcctccaggtcactatgacaagtgt
gtgtttgcccttcgggaggagaacaagagtgacatgaacactgtgctgaactacatcttc
tcccacgctcaggtcaccaagaagaacctgctggtcacgatgctcattgaccagttgtgc
ggccgggatcccaccctgaccgacgaactgctgaacatcctcaccgagctgacccagctc
agcaagaccaccaatgccaaagtggccctgcgagcccgacaggttctaatagcctcccat
ctgccatcctacgaactgcgtcataaccaagtggagtccatctttctgtccgcgattgac
atgtacggacaccagttctgcatcgagaacctgcagaaactcatcttgtctgaaacatcc
atttttgatgtcctcccaaatttcttctaccacagcaaccaggtggtgagaatggcagct
ctggaggtatatgtcagaagggcctatatcgcctatgagctcaacagcgtacagcatcgt
cagctgaaggacaacacgtgcgtggtggaatttcagttcatgcttcctacatcccatcca
aatagagggaacatccccacgctaaacagaatgtccttctcctccaacctcaaccactat
ggcatggctcacgtggccagcgtcagcgacgtgctgctggacaactccttcaccccgccg
tgccagaggatgggggggatggtctccttccgaaccttcgaagacttcgtcaggatcttt
gatgaagtgatgggctgtttctgtgactcccctcctcaaagccccacgttccccgaggcg
ggccacacctccctgtatgatgaagaaaaggctgccagagatgagccaatccacatcctg
aatgtggccatcaagacggactgtgacatcgaggacgacgggctggcggccatattcaga
gagtttacccagtgcaagaaagccgtcctcatagaacatgggatccgtcgacttactttc
ctggttgcacaaaaggatttcagaaagcaggtcaactatgaggtggatcaaagatttcat
agagagttccccaaatttttcacgttccgagcaagagataagtttgaggaggatcgcatc
tatcgacacttagagcccgcactggcttttcagctggagctaaaccgcatgcgaaacttc
gacctcactgccatcccgtgcgccaatcataagatgcacttgtacctgggggcagccaag
gtggaagtgggtatagaagttaccgactacaggttcttcgtgagggcgatcatcaggcat
tctgacctggtcaccaagatcgaggagtcggtgcggagtatggtgatgcgctacgggagt
cggctctggaaactccgagtccttcaggcggaactgaaaatcaacattcgcctgactccg
accggaaaagcgattcccatccgcctcttcctaaccaatgagtccggctattacttggac
attagcctttacaaggaagtgaccgactccaggacagcacagattatgttccaggcctac
ggagacaaacagggaccactgcatggcatgctgatcaatactccctacgtgaccaaggac
ctactgcagtctaagcggtttcaggcccagaccttaggaacgacctacatctatgacatt
ccggagatgtttcgacagtcgctgcttaaactctgggagtccatggccgctcaggcattc
ctgccctcaccgcccctaccttccgacatactgacgtataccgaactggtgttggacgat
caaggtcagctagtacatatgaacaggcttccaggaggaaatgagattggcatggtagcc
tggaaaatgacgcttaagagccccgagtacccagagggcagagacatcattgttatcggc
aacgacatcacttaccgaatcggttcctttgggccgcaggaggacatcttgtttctgagg
gcctctgagcttgccagagcgcaaggcatcccccgcatttacgtggcggcgaatagcgga
gcgagaataggattagccgaagagatccgccacatgtttcacgtggcttgggtggatcct
gccgatccatacaagggatacaagtacttgtatctgactcctcaagattacaagaaagtc
agtgccctgaactcggttcactgtgagcatgtggaggatgaaggagaatccaggtacaag
ataacggatattatcgggaaggaagaaggccttggagcagagaacctgagaggctctggg
atgattgctggagaatcctcattggcctacgacaagataatcaccatcagcttggtttca
tgtcgggccattgggattggggcgtatcttgtccgattagcccagagaactatccaggtt
gagaactcacatttgattttgaccggagctgcagcccttaataaagtgcttggacgggag
gtgtatacctccaacaatcagcttgggggcatccagattatgcacaacaatggggtgacg
catagcactgtgtgcgatgactttgaaggggttctgaccatcctccactggctatcctac
atgccgaagaacgtatacagtccagttcctatgctcaactccaaggatcctatagaccga
atcattgaatttgtccctaccaaagccccatatgatccccgctggatgctggcaggacgg
ccacacccaggccagaaaggccagtggctgagtggattttttgactacggctccttctcg
gagattatgcaaccttgggcccagaccgtagtggttggtcgagccaggctgggaggaata
cctgtaggagtggttgccgtagaaaccagaacggtggagctaagtatcccagctgatcct
gcaaacctggattctgaggccaagatcatccaacaggctggccaggtttggttcccagac
tcggccttcaagacgtatcaagctatcaaggacttcaaccgggaggggctgcctctgatg
gtgtttgccaactggagaggtttttctggtggaatgaaagacatgtacgaccaggtgctg
aagttcggcgcctacatcgtggacggcttacgcgagtgctctcagccggtcctggtttac
atccctcctcaggccgagctccggggagggtcctgggtcgtcatcgatcccaccatcaac
ccccggcacatggagatgtacgcggaccgggaaagcaggggatcggtcctggaaccagag
gggacggtggaaatcaaattccgcaaaaaggatttggtgaagaccatgcgccgagtggac
ccagtctacatccacctggcggagcgtctaggcaccccagagctcagccccgccgagcgg
aaggagctggaagccaagctgaaggagcgggaggaattcctcactcccatctaccaccag
gtcgccgtgcagtttgccgacttgcatgacacgccgggccggatgcaggagaagggggtc
attaacgatatcctggactggaaaacctcccggaccttcttctactggagactgaggcgc
ctcttgctggaggacttggtgaagaagaagatccacgacgccaaccccgagttgacggac
ggacagatccaagccatgttgaggcgctggtttgtggaagtcgagggaacggtaaaggcc
tacgtgtgggacaacaacaaggatctggtggagtggctggagaagcagctaaatgaagag
gagggcgcccgctcggtggtcgacgaaaacatcaagtacatctccagagattacatactc
aagcagatccgtagcttggtgcaggccaatccggaggtggccatggattccatcgtccac
atgacccaacacatctcgccgactcaacgcgcggaagtggtgcggatcctctcgacgatg
gattcccctccttcgacgtag

DBGET integrated database retrieval system