KEGG   Ornithorhynchus anatinus (platypus): 100078619Help
Entry
100078619         CDS       T01045                                 

Definition
aromatase
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100078619
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100078619
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     100078619
Cytochrome P450 [BR:oaa00199]
 Cytochrome P450, animal type
  CYP19 family
   100078619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 484 aa AA seqDB search
ILTLLLLLLLLLLAGTPLALWSGRDAAAIPGPGYCLGLGPLVSHGRFLWMGIGSACNYYN
RMYGEFMRVWIGGEETLIISKSSSMFHIMKHNHYSCRFGSKLGLQCIGMHEKGIIFNNNP
TLWKAIRPFFTKALSGPGLVHMVAMCVQSTITHLDKLDEVTNELGYISVLTLMRRIMLNT
SNALFLGIPMDESEMVMKIQGYFNAWQALLLKPDIFFKVSWLYKKYAKSIKELQDAVETL
LDEKRLRLSAAEKLEDHVDFASQLIFAQDRGDLTRENVNQCMLEMLIAAPGARSVTIFFM
LLLIAKHPNVEQAIVEEIRTEIGDRDIEMEDMQKLKVVESFIFESMRYQPVVDLVMRKAL
QDDVIDGYPVKKGTNIILNIGRMHRREFFPKPDEFTLENFAKNVPYRYFQPFGFGPRSCA
GKYIAMVMMKSILVTLLRRYHVQELEGGIEGVHKRNDLALHPDETGASLDMIFTPRTPGL
LRQP
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
attctgacgctgctgctgctgctgctcctcctcctcctggccggcaccccgctcgcgctc
tggagcggccgggacgctgccgccattccaggtcccgggtactgcctggggctcgggccc
ctggtgtcccacggcaggttcctgtggatggggatcggcagcgcctgcaactattacaat
cggatgtacggagagttcatgcgagtctggataggtggcgaggagacgctcatcatcagc
aagtcgtccagcatgttccacatcatgaagcacaaccactacagctgtcgcttcgggagt
aagctgggcctgcagtgtatcggcatgcacgagaagggcatcatcttcaacaacaacccc
accctctggaaagccatccgacccttcttcaccaaagccttgtccggaccgggcctcgtg
cacatggtggccatgtgcgtgcagtccaccatcacacacctggacaagttggatgaagtg
accaatgagctgggctacatcagtgtgctgactctcatgcgccgcatcatgctgaacacc
tccaatgctttgttcctggggatccccatggatgagtcggagatggtgatgaaaatccag
ggctatttcaatgcctggcaggcgctcctcctcaagcccgacatcttcttcaaggtctcg
tggctgtacaaaaagtatgcaaagtccatcaaggagctccaagacgccgtggagaccctg
ttggatgagaagagactccgcctctctgcggctgagaagcttgaagaccacgtggacttt
gcctcgcagctcatctttgcccaggaccgcggggatctgaccagggagaatgtgaaccag
tgcatgctggagatgctgattgccgctccgggcgcgaggtccgtcaccatcttcttcatg
ttgctgctcatcgccaagcaccccaacgtcgagcaggccatcgtggaggagatccggacg
gagatcggcgaccgggacatcgagatggaggacatgcagaagctgaaagtggtggagagc
ttcatcttcgagagcatgcgctaccagcccgtagtcgacctggtcatgcgcaaggccctg
caggacgacgtgattgacggctacccggtcaagaagggcaccaacatcatcctcaacatc
ggccgcatgcaccgccgggagttcttccccaaacccgacgagttcaccctggagaacttc
gccaagaacgtcccctaccgctacttccagcccttcgggttcgggcctcgcagctgcgcg
gggaagtacatcgccatggtgatgatgaagagcatcctcgtcacgctgctgcggcgctac
cacgtgcaggagctcgagggcggcatcgagggcgtccacaagaggaacgacctggccctg
cacccggacgagaccggggcctcgctggacatgatcttcaccccgcggacccccggcctc
ctccgccagccctga

DBGET integrated database retrieval system