KEGG   Ornithorhynchus anatinus (platypus): 100078639Help
Entry
100078639         CDS       T01045                                 

Gene name
CLTC
Definition
clathrin, heavy chain (Hc)
Orthology
K04646  
clathrin heavy chain
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100078639 (CLTC)
   04142 Lysosome
    100078639 (CLTC)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100078639 (CLTC)
  Nervous system
   04721 Synaptic vesicle cycle
    100078639 (CLTC)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100078639 (CLTC)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100078639 (CLTC)
Exosome [BR:oaa04147]
 Exosomal proteins
  Proteins found in most exosomes
   100078639 (CLTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1700 aa AA seqDB search
MLKATTEAERQFLLSRNLQSSVEKLAAIFLFQLQNLGINPANIGFSTLTMESDKFICIRE
KVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAH
TMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQ
KWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRG
QAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYI
HLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVL
QNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQ
SVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEE
LGDLVKSVDPTLALSVYLRANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVM
RISPDQGQQFAQMLVQDEEPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQT
RLLEMNLMHAPQVADAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVH
THLLNPEWLVNYFGSLSVEDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELF
ESFKSFEGLFYFLGSIVNFSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNF
LKEAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDV
DCSEDVIKNLILVVRGQFSTDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKI
YIDSNNNPERFLRENPYYDSRVVGKYCEKRDPHLACVAYERGQCDIELINVCNENSLFKS
LSRYLVRRKDPELWGSVLLESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPN
ELIELLEKIVLDNSVFSEHRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISN
ELFEEAFAIFRKFDVNTSAVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVK
EAIDSYIKADDPSSYMEVVQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNR
LAELEEFINGPNNAHIQQVGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVD
GARKANSTRTWKEVCFACVDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITM
LEAALGLERAHMGMFTELAILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELV
FLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDL
LMVLSPRLDHTRAVNYFSKVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRT
SIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFKGNNRWKQSVELCKKDRLYKDAMQYAS
ESKDTELAEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQV
MKEYLSKVDAIKEKVDKLDASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPF
GYGYTAPPYGQPQPGFGYSM
NT seq 5103 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaagctacaacagaagccgaacgccagttcctgctctcgaggaacttgcagtcc
agtgtggagaaactggcagcaatctttctctttcagctccaaaatctgggtatcaaccca
gcaaacatcggcttcagcactctgactatggagtcagacaaattcatctgtattagagag
aaagtaggagaacaggcacaggtggtaatcatcgacatgaatgacccaagtaatcctatt
cgccgaccgatttcagccgacagtgccatcatgaatccagccagcaaagtcattgctttg
aaagctgggaaaacccttcaaatctttaacattgagatgaaaagtaagatgaaggcccac
actatgacagatgacgtcaccttctggaaatggatatcgctgaacactgttgctcttgtc
acggacaatgcagtctatcactggagcatggaaggagagtctcaaccagtgaaaatgttt
gatcgtcattctagccttgcggggtgtcagatcatcaattatcgtactgatgcgaagcag
aaatggttgcttttaactggcatatccgcacagcaaaatcgagtggtgggggccatgcag
ctctactctgtagacaggaaagtgtctcagcccattgagggccacgcggccagtttcgca
cagtttaagatggaaggaaatgccgaagagtcgacactgttctgttttgcagtaagggga
caagctggcggcaagttgcatatcattgaagtgggaacaccacctacaggaaaccaacca
tttcctaagaaagcagttgatgtatttttccctcccgaggcacaaaacgactttcccgtg
gcaatgcagatcagtgaaaagcatgatgtggttttcctgattaccaaatatggctacatt
cacttgtatgacctcgagactggcacgtgcatctacatgaatcgaatcagtggggagacg
atttttgtaacggcgcctcacgaagccacagctggaattattggcgtaaaccgcaaggga
caagtgctgtcagtatgtgtggaggaagaaaacataattccttacatcacaaacgtgctt
cagaatcccgatctggctttgaggatggctgtacgcaacaacttagctggagccgaagaa
ctctttgcccgaaaatttaatgctctctttgcccaggggaactactcagaggcagccaaa
gtggctgcaaacgcaccaaagggaatcctacgtactccagacaccattcgtcggttccag
agtgttcctgcccagccgggtcagacttctcccctgctccagtatttcgggatcctgttg
gaccagggccagctgaacaaatacgagtccttagagctctgtaggcctgtgcttcaacag
ggtcggaaacagctgttggagaaatggttgaaagaagacaagctggaatgctcggaagaa
ttgggagatctggtgaagtccgtggatccgacgctggcacttagcgtgtacctaagagca
aatgtgccaaacaaagttattcagtgttttgccgaaacgggtcaagtccagaagattgtc
ttatatgcaaagaaagtgggttatactccagactggatctttttgctgagaaatgtaatg
cgaattagccccgaccagggacaacagtttgctcaaatgctggttcaggatgaagagcct
cttgctgatatcacacagattgttgatgtgtttatggagtacaacctaattcaacaatgc
acagcattcctgctagatgccctgaagaacaatcgcccttcagaggggcctcttcaaaca
cgcttactggagatgaacctcatgcacgccccgcaagttgcagatgctattttaggcaat
cagatgttcacccattatgaccgagctcacattgctcagctgtgcgagaaggctggtctg
ctgcagcgagcgctggaacacttcacagatctgtatgacattaagcgtgcggtggttcac
actcaccttctcaatcctgagtggctagtaaattatttcggctccttatcggtagaagat
tccctggagtgtctgcgggccatgctctctgccaatattcgtcagaacttgcagatttgt
gtccaagtagcttccaagtatcacgagcagctctccacccaatcgttgattgaactcttt
gaatctttcaaaagttttgaaggtctattttatttcctgggctccattgttaacttcagt
caggacccagacgtacacttcaaatatattcaggctgcctgtaagactgggcagattaaa
gaggtggaaagaatttgcagggaaagcaactgctatgatccagaacgtgtcaaaaacttc
ctcaaggaagcaaagctgaccgaccagttaccgcttatcattgtctgtgatagatttgac
tttgttcatgatttggtgctctacttgtacagaaataaccttcagaaatatattgagatt
tatgtacagaaggtgaatccaagccggcttcctgttgttattggcgggttgcttgatgtg
gattgttcagaagatgtcataaagaacttgatcctagttgtgagaggtcaattctctact
gacgaacttgttgctgaagttgagaaaagaaacaggttaaaactgcttctgccttggcta
gaagccagaattcatgaaggttgtgaggagcccgctactcacaacgccctagccaaaatc
tacatcgatagcaacaacaacccagaaagatttctgcgtgaaaatccgtactacgacagt
agagttgttgggaaatactgtgagaagagagaccctcacttggcgtgtgtggcttatgag
cgtggccagtgtgatatagaacttataaatgtgtgcaacgagaactcacttttcaaaagt
ctgtcccgttacttagtacgacgcaaagatccagaactttggggcagtgtgttgctggag
agcaatccttaccggaggcctcttatcgaccaggttgtacagacagccctgtctgagact
caggatcccgaagaggtgtccgtaaccgtcaaggctttcatgactgcagaccttcccaat
gaacttattgaactgttggagaaaattgtgctcgacaactctgtgttcagtgaacacagg
aatctgcaaaacctcctaattctcacggcaattaaagctgaccgaacccgtgtcatggaa
tacatcaaccgtctggataactacgatgctccagatattgctaacatcgccatcagcaat
gagttgtttgaggaagcatttgccattttcaggaaatttgatgtgaacacttctgctgtg
caggtcttgattgaacatatcgggaatctggatcgtgcatatgagtttgccgagcgctgt
aacgaacccgccgtctggagtcaactagcaaaggcccagttacagaaagggatggtgaaa
gaagccatcgattcttacatcaaagctgacgacccctcatcctacatggaggttgttcaa
gctgccaatactagtggaaactgggaggaactggtgaagtatctgcagatggcccgtaag
aaggctcgcgaatcttacgtggagacagaactgatctttgctcttgctaaaacaaaccgt
ctggctgaactggaagaattcatcaatgggcccaacaatgcccacatccagcaagttggt
gaccgctgctatgatgagaaaatgtatgatgctgctaaattgttgtacaacaatgtttca
aacttcggtcgtctggcctcgactctggttcatctgggtgaatatcaggcagccgttgat
ggggcccggaaagctaatagcactcgaacatggaaggaggtctgctttgcttgtgtggat
ggcaaagaatttcgtctagctcaaatgtgtgggcttcacatcgtggttcatgcagacgaa
ttggaagaactcatcaactactatcaggatcgtggctactttgaagagctgattaccatg
ttggaagcagccctgggacttgaacgagctcacatgggaatgttcactgaactggccatc
ctctactctaaattcaaacctcaaaaaatgagggaacacttggagctgttctggtccaga
gtgaatatccccaaggtgctaagagcagcagaacaagctcatctttgggcagagctggtg
tttctgtatgacaagtacgaagaatatgataatgctataatcactatgatgaatcatcca
acagatgcgtggaaggaaggtcaatttaaagatattatcaccaaggtggccaatgtggaa
ctctactatagagcaatacagttctatctagaattcaaacctctgttactaaatgatctg
ctgatggtactttctccacggttggatcatactcgtgctgtcaactatttcagtaaggtt
aaacagttgccactggtcaaaccgtacttgcgctcagttcagaaccataacaacaaatct
gtgaatgagtctctgaataacctgttcattacagaagaagattaccaggcgctgcggaca
tcaatagatgcctatgacaactttgacaatatttcccttgctcaacgcctggaaaaacac
gagttgatagagttcagaagaattgccgcatatctcttcaaaggcaacaatcgctggaaa
cagagtgtagaactgtgcaaaaaggataggctttacaaggatgcgatgcagtatgcctcc
gaatcgaaagatacagagttggcagaagagctcctgcaatggtttttacaggaagaaaag
agagaatgctttggggcttgtctcttcacctgttatgatcttttaaggccagatgttgtc
ttggaaactgcctggaggcataatatcatggactttgccatgccctacttcattcaggtc
atgaaggaatatttgtccaaggttgatgcaataaaggaaaaggtggataaactggatgcc
tctgagtctctgagaaaagaagaggagcaagctactgagacccagcctattgtatatggc
cagccgcagttgatgttgacagcaggacccagtgttgctgttcctccacaagcacctttt
ggctatggctacaccgcccctccctatggacagccacagcctggtttcggatacagcatg
taa

DBGET integrated database retrieval system