KEGG   Ornithorhynchus anatinus (platypus): 100078757Help
Entry
100078757         CDS       T01045                                 

Gene name
PLCG1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00562  Inositol phosphate metabolism
oaa01100  Metabolic pathways
oaa01521  EGFR tyrosine kinase inhibitor resistance
oaa04012  ErbB signaling pathway
oaa04014  Ras signaling pathway
oaa04015  Rap1 signaling pathway
oaa04020  Calcium signaling pathway
oaa04064  NF-kappa B signaling pathway
oaa04066  HIF-1 signaling pathway
oaa04070  Phosphatidylinositol signaling system
oaa04072  Phospholipase D signaling pathway
oaa04360  Axon guidance
oaa04370  VEGF signaling pathway
oaa04650  Natural killer cell mediated cytotoxicity
oaa04658  Th1 and Th2 cell differentiation
oaa04659  Th17 cell differentiation
oaa04660  T cell receptor signaling pathway
oaa04664  Fc epsilon RI signaling pathway
oaa04666  Fc gamma R-mediated phagocytosis
oaa04670  Leukocyte transendothelial migration
oaa04722  Neurotrophin signaling pathway
oaa04750  Inflammatory mediator regulation of TRP channels
oaa04919  Thyroid hormone signaling pathway
oaa04933  AGE-RAGE signaling pathway in diabetic complications
oaa05167  Kaposi's sarcoma-associated herpesvirus infection
oaa05169  Epstein-Barr virus infection
oaa05200  Pathways in cancer
oaa05205  Proteoglycans in cancer
oaa05206  MicroRNAs in cancer
oaa05214  Glioma
oaa05223  Non-small cell lung cancer
oaa05225  Hepatocellular carcinoma
oaa05231  Choline metabolism in cancer
Module
oaa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100078757 (PLCG1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100078757 (PLCG1)
   04015 Rap1 signaling pathway
    100078757 (PLCG1)
   04012 ErbB signaling pathway
    100078757 (PLCG1)
   04370 VEGF signaling pathway
    100078757 (PLCG1)
   04064 NF-kappa B signaling pathway
    100078757 (PLCG1)
   04066 HIF-1 signaling pathway
    100078757 (PLCG1)
   04020 Calcium signaling pathway
    100078757 (PLCG1)
   04070 Phosphatidylinositol signaling system
    100078757 (PLCG1)
   04072 Phospholipase D signaling pathway
    100078757 (PLCG1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100078757 (PLCG1)
   04660 T cell receptor signaling pathway
    100078757 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    100078757 (PLCG1)
   04659 Th17 cell differentiation
    100078757 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    100078757 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    100078757 (PLCG1)
   04670 Leukocyte transendothelial migration
    100078757 (PLCG1)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100078757 (PLCG1)
  Nervous system
   04722 Neurotrophin signaling pathway
    100078757 (PLCG1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100078757 (PLCG1)
  Development
   04360 Axon guidance
    100078757 (PLCG1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100078757 (PLCG1)
   05231 Choline metabolism in cancer
    100078757 (PLCG1)
   05206 MicroRNAs in cancer
    100078757 (PLCG1)
   05205 Proteoglycans in cancer
    100078757 (PLCG1)
   05225 Hepatocellular carcinoma
    100078757 (PLCG1)
   05214 Glioma
    100078757 (PLCG1)
   05223 Non-small cell lung cancer
    100078757 (PLCG1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100078757 (PLCG1)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100078757 (PLCG1)
   05169 Epstein-Barr virus infection
    100078757 (PLCG1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100078757 (PLCG1)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100078757 (PLCG1)
Membrane trafficking [BR:oaa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100078757 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100078757 (PLCG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2 C2 PI-PLC-Y PH
Motif
Other DBs
NCBI-GeneID: 100078757
NCBI-ProteinID: XP_007667023
Position
Un
AA seq 623 aa AA seqDB search
MAAAAGAVGAFNGFAPCIQSEAQAAHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETR
QITWSRGSDKIEGGTACHLSCFIWCCTGVVASLNFSLLYRWYHASLTRTQAEHMLMRVPR
DGAFLVRKRSEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLY
RKMRLRYPINEETLEKIGTAGGRGGTEGILQEFSGGAQSDRDGLSPESWRLGMTQPGSPR
ASNCPGPGTLRVGVGERAGRLGVRLTAPPHASSPAAIRPEGKNSRLYVFSVSMASLSHWS
LDVAADTQEDLQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYCRPVPFDEE
TAAVWVGVAAAAPPLPTDKPMQMNQALFMSGGRCGYVMQPCSMRDDVFDPFDKNSLRGLE
SWTINIEVLGARHLPKNGRGIVCPFVEIEVSGADYDNAKQKTEFVVDNGLNPVWPPKPFQ
FQIINPEFAFLRFVVYEEDMFSDQNFLAQATFLVKGLKSGYRAVPLKNNYSEDLELASLL
IKINIHPAKENGELSQFSPASLRERGSDSGQLLNSRPRVGSFEARYQQPFEDFRLSPEQL
AEHFEVRERRALRRTRVNGDNRL
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagcggcaggggctgtgggcgccttcaacggtttcgcgccctgcatccagtcc
gaggcccaggccgcccacctctgccggagcctggaggtgggcaccgtgatgactttgttt
tactcgaaaaaatctcagcggccggagaggaaaactttccaggtcaaactggaaaccagg
cagatcacatggagcagaggctcggataaaatcgaaggaggcaccgcctgccacctctcc
tgcttcatctggtgctgcaccggtgtggtggccagtttgaatttctctcttctgtatagg
tggtaccacgccagcctaacgcggacccaggcggagcacatgctcatgagggtcccgcgg
gatggggccttccttgtgcgcaagaggagcgagcccaactcctacgccatttccttccgg
gcggaagggaagatcaagcactgccgcgtccagcaggagggccagacggtcatgctgggc
aactcggagttcgacagcctcgtggacctcatcagctactacgagaagcacccgctgtac
cgcaagatgagactgcgttatcctatcaatgaggagacgctggagaagataggcaccgcg
ggggggaggggcggcacagagggaattttacaagagttttccgggggcgcacaaagtgac
cgggacgggctctctccggagagctggcggttggggatgacacagccgggctctccgaga
gccagcaactgccccgggcctgggaccctccgggtgggggtgggggaacgggctggaagg
ctcggcgtccggctgacggccccaccccacgcttcgtccccggcagccatccgcccggag
gggaagaacagccggctgtacgtattctccgtgagcatggcctcgttgtcgcactggtct
ctggacgtggcggccgacacgcaggaggacctgcaggactgggtgaagaagattcgcgag
gtggcccagaccgcagacgccaggctcacagaagggaagatgatggaacgaaggaagaag
atcgccttggagctgtccgagctggtcgtctactgccggccggtgcctttcgatgaagag
acagcagcggtgtgggtgggcgtggccgctgcagcccctcccctgcccacagacaagccc
atgcagatgaaccaggcgctgttcatgtccggcggccgctgtggctacgtgatgcagccc
tgcagcatgcgcgacgacgtcttcgaccccttcgacaagaacagcctccgcggtctcgag
tcgtggaccattaacatcgaggtcctgggggctcggcatctgcccaagaacggcaggggc
atcgtgtgcccatttgtggagatcgaggtgtctggggccgactatgacaacgccaagcag
aagaccgaatttgtggtggacaacggtctgaaccccgtatggccccccaagcccttccag
ttccagatcatcaaccctgagtttgccttcctgcgcttcgtcgtgtatgaagaggacatg
ttcagtgaccaaaacttcctggcccaggccacattcctggtgaaaggactgaaatcagga
tacagagcggtgcccctgaagaacaactacagcgaggacttggagttggcttctctcctc
attaagatcaacatccacccggccaaggagaacggcgagctgagccagttcagccccgcg
tccctgcgagagcggggtagcgactcgggccagctcctcaatagccgcccccgcgtgggc
tccttcgaagcccgctaccagcagccgttcgaggacttccgtctttccccggagcagcta
gccgagcacttcgaggtccgggagcgaagggccttgcggaggaccagagtcaacggagac
aatcgcctctag

DBGET integrated database retrieval system