KEGG   Ornithorhynchus anatinus (platypus): 100078818Help
Entry
100078818         CDS       T01045                                 

Gene name
DCK
Definition
deoxycytidine kinase
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100078818 (DCK)
   00240 Pyrimidine metabolism
    100078818 (DCK)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100078818 (DCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 260 aa AA seqDB search
MATPPKRICPPPEPSPVGTRIKKVSIEGNIAAGKSTFVNILKQVCESWEVVPEPIARWCN
VQSAQDEFEELSTSQKSGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLAALGGKLRQAP
EPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWTNSQFGQSLHLDGIIYLRA
TPEKCLNRIYLRGRDEEQGIPLEYLEKLHYKHESWLQQRTLKTNFDYLQEVPILSLDVNE
DFKDKHANLIEKVKEFLSTL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccgcccaagaggatctgccccccgccggagcccagccccgtcgggacccgc
atcaagaaggtctccatcgagggcaacatcgctgctgggaagtcaacgttcgtgaatatc
ctcaaacaagtgtgcgagtcctgggaagtggttcccgaacccatcgcccggtggtgcaac
gtgcagagcgctcaagatgaatttgaggagctgtcgacgtctcagaagagcggcgggaac
gtgctgcagatgatgtacgagaagccggagcgctggtccttcaccttccagacgtacgcc
tgcctgagccggatccgggcccagctggccgccctcggcgggaagctccgccaggcgccg
gagcccgtgcttttcttcgagcgctcggtgtacagcgatcggtacatatttgcatctaac
ctgtacgaatctgactgcatgaacgaaacggagtggacgatttaccaagactggcacgat
tggacgaatagccagtttggccaaagcctccacctggatgggatcatttatctccgagcc
accccagagaaatgcttaaatcggatttatttgcggggcagggatgaggaacaaggaatt
cctcttgagtacttggagaagcttcactacaagcacgaaagctggcttcagcaaagaacc
ctgaagaccaactttgactatcttcaagaagtgcccatcttatcgctggatgttaatgaa
gatttcaaagacaagcatgccaatctcattgaaaaggtcaaagagtttttgagtactttg
tga

DBGET integrated database retrieval system