KEGG   Ornithorhynchus anatinus (platypus): 100078818Help
Entry
100078818         CDS       T01045                                 

Definition
deoxycytidine kinase-like
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:oaa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:oaa00240]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 260 aa AA seqDB search
MATPPKRICPPPEPSPVGTRIKKVSIEGNIAAGKSTFVNILKQVCESWEVVPEPIARWCN
VQSAQDEFEELSTSQKSGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLAALGGKLRQAP
EPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWTNSQFGQSLHLDGIIYLRA
TPEKCLNRIYLRGRDEEQGIPLEYLEKLHYKHESWLQQRTLKTNFDYLQEVPILSLDVNE
DFKDKHANLIEKVKEFLSTL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccgcccaagaggatctgccccccgccggagcccagccccgtcgggacccgc
atcaagaaggtctccatcgagggcaacatcgctgctgggaagtcaacgttcgtgaatatc
ctcaaacaagtgtgcgagtcctgggaagtggttcccgaacccatcgcccggtggtgcaac
gtgcagagcgctcaagatgaatttgaggagctgtcgacgtctcagaagagcggcgggaac
gtgctgcagatgatgtacgagaagccggagcgctggtccttcaccttccagacgtacgcc
tgcctgagccggatccgggcccagctggccgccctcggcgggaagctccgccaggcgccg
gagcccgtgcttttcttcgagcgctcggtgtacagcgatcggtacatatttgcatctaac
ctgtacgaatctgactgcatgaacgaaacggagtggacgatttaccaagactggcacgat
tggacgaatagccagtttggccaaagcctccacctggatgggatcatttatctccgagcc
accccagagaaatgcttaaatcggatttatttgcggggcagggatgaggaacaaggaatt
cctcttgagtacttggagaagcttcactacaagcacgaaagctggcttcagcaaagaacc
ctgaagaccaactttgactatcttcaagaagtgcccatcttatcgctggatgttaatgaa
gatttcaaagacaagcatgccaatctcattgaaaaggtcaaagagtttttgagtactttg
tga

DBGET integrated database retrieval system