KEGG   Ornithorhynchus anatinus (platypus): 100078846Help
Entry
100078846         CDS       T01045                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa01522  Endocrine resistance
oaa04010  MAPK signaling pathway
oaa04014  Ras signaling pathway
oaa04020  Calcium signaling pathway
oaa04024  cAMP signaling pathway
oaa04062  Chemokine signaling pathway
oaa04114  Oocyte meiosis
oaa04140  Autophagy - animal
oaa04211  Longevity regulating pathway
oaa04213  Longevity regulating pathway - multiple species
oaa04261  Adrenergic signaling in cardiomyocytes
oaa04270  Vascular smooth muscle contraction
oaa04310  Wnt signaling pathway
oaa04340  Hedgehog signaling pathway
oaa04371  Apelin signaling pathway
oaa04530  Tight junction
oaa04540  Gap junction
oaa04611  Platelet activation
oaa04713  Circadian entrainment
oaa04714  Thermogenesis
oaa04720  Long-term potentiation
oaa04723  Retrograde endocannabinoid signaling
oaa04724  Glutamatergic synapse
oaa04725  Cholinergic synapse
oaa04726  Serotonergic synapse
oaa04727  GABAergic synapse
oaa04728  Dopaminergic synapse
oaa04740  Olfactory transduction
oaa04742  Taste transduction
oaa04750  Inflammatory mediator regulation of TRP channels
oaa04910  Insulin signaling pathway
oaa04911  Insulin secretion
oaa04912  GnRH signaling pathway
oaa04913  Ovarian steroidogenesis
oaa04914  Progesterone-mediated oocyte maturation
oaa04915  Estrogen signaling pathway
oaa04916  Melanogenesis
oaa04918  Thyroid hormone synthesis
oaa04919  Thyroid hormone signaling pathway
oaa04921  Oxytocin signaling pathway
oaa04922  Glucagon signaling pathway
oaa04923  Regulation of lipolysis in adipocytes
oaa04924  Renin secretion
oaa04925  Aldosterone synthesis and secretion
oaa04926  Relaxin signaling pathway
oaa04927  Cortisol synthesis and secretion
oaa04928  Parathyroid hormone synthesis, secretion and action
oaa04934  Cushing's syndrome
oaa04961  Endocrine and other factor-regulated calcium reabsorption
oaa04962  Vasopressin-regulated water reabsorption
oaa04970  Salivary secretion
oaa04971  Gastric acid secretion
oaa04976  Bile secretion
oaa05012  Parkinson's disease
oaa05020  Prion diseases
oaa05030  Cocaine addiction
oaa05031  Amphetamine addiction
oaa05032  Morphine addiction
oaa05146  Amoebiasis
oaa05165  Human papillomavirus infection
oaa05166  HTLV-I infection
oaa05169  Epstein-Barr virus infection
oaa05200  Pathways in cancer
oaa05203  Viral carcinogenesis
oaa05205  Proteoglycans in cancer
oaa05414  Dilated cardiomyopathy (DCM)
Module
oaa_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100078846 (PRKACB)
   04010 MAPK signaling pathway
    100078846 (PRKACB)
   04310 Wnt signaling pathway
    100078846 (PRKACB)
   04340 Hedgehog signaling pathway
    100078846 (PRKACB)
   04371 Apelin signaling pathway
    100078846 (PRKACB)
   04020 Calcium signaling pathway
    100078846 (PRKACB)
   04024 cAMP signaling pathway
    100078846 (PRKACB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100078846 (PRKACB)
  Cell growth and death
   04114 Oocyte meiosis
    100078846 (PRKACB)
  Cellular community - eukaryotes
   04530 Tight junction
    100078846 (PRKACB)
   04540 Gap junction
    100078846 (PRKACB)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100078846 (PRKACB)
   04062 Chemokine signaling pathway
    100078846 (PRKACB)
  Endocrine system
   04911 Insulin secretion
    100078846 (PRKACB)
   04910 Insulin signaling pathway
    100078846 (PRKACB)
   04922 Glucagon signaling pathway
    100078846 (PRKACB)
   04923 Regulation of lipolysis in adipocyte
    100078846 (PRKACB)
   04912 GnRH signaling pathway
    100078846 (PRKACB)
   04913 Ovarian Steroidogenesis
    100078846 (PRKACB)
   04915 Estrogen signaling pathway
    100078846 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    100078846 (PRKACB)
   04921 Oxytocin signaling pathway
    100078846 (PRKACB)
   04926 Relaxin signaling pathway
    100078846 (PRKACB)
   04918 Thyroid hormone synthesis
    100078846 (PRKACB)
   04919 Thyroid hormone signaling pathway
    100078846 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    100078846 (PRKACB)
   04916 Melanogenesis
    100078846 (PRKACB)
   04924 Renin secretion
    100078846 (PRKACB)
   04925 Aldosterone synthesis and secretion
    100078846 (PRKACB)
   04927 Cortisol synthesis and secretion
    100078846 (PRKACB)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100078846 (PRKACB)
   04270 Vascular smooth muscle contraction
    100078846 (PRKACB)
  Digestive system
   04970 Salivary secretion
    100078846 (PRKACB)
   04971 Gastric acid secretion
    100078846 (PRKACB)
   04976 Bile secretion
    100078846 (PRKACB)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100078846 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100078846 (PRKACB)
  Nervous system
   04724 Glutamatergic synapse
    100078846 (PRKACB)
   04727 GABAergic synapse
    100078846 (PRKACB)
   04725 Cholinergic synapse
    100078846 (PRKACB)
   04728 Dopaminergic synapse
    100078846 (PRKACB)
   04726 Serotonergic synapse
    100078846 (PRKACB)
   04720 Long-term potentiation
    100078846 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    100078846 (PRKACB)
  Sensory system
   04740 Olfactory transduction
    100078846 (PRKACB)
   04742 Taste transduction
    100078846 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    100078846 (PRKACB)
  Aging
   04211 Longevity regulating pathway - mammal
    100078846 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    100078846 (PRKACB)
  Environmental adaptation
   04713 Circadian entrainment
    100078846 (PRKACB)
   04714 Thermogenesis
    100078846 (PRKACB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100078846 (PRKACB)
   05205 Proteoglycans in cancer
    100078846 (PRKACB)
   05203 Viral carcinogenesis
    100078846 (PRKACB)
  Neurodegenerative diseases
   05012 Parkinson's disease
    100078846 (PRKACB)
   05020 Prion diseases
    100078846 (PRKACB)
  Substance dependence
   05030 Cocaine addiction
    100078846 (PRKACB)
   05031 Amphetamine addiction
    100078846 (PRKACB)
   05032 Morphine addiction
    100078846 (PRKACB)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    100078846 (PRKACB)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    100078846 (PRKACB)
  Infectious diseases
   05166 HTLV-I infection
    100078846 (PRKACB)
   05169 Epstein-Barr virus infection
    100078846 (PRKACB)
   05165 Human papillomavirus infection
    100078846 (PRKACB)
   05146 Amoebiasis
    100078846 (PRKACB)
  Drug resistance
   01522 Endocrine resistance
    100078846 (PRKACB)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100078846 (PRKACB)
Protein kinases [BR:oaa01001]
 Serine/threonine kinases: AGC group
  PKA family
   100078846 (PRKACB)
Messenger RNA biogenesis [BR:oaa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100078846 (PRKACB)
Chromosome and associated proteins [BR:oaa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100078846 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 100078846
NCBI-ProteinID: XP_001509843
Position
Un
AA seq 233 aa AA seqDB search
MVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQ
GYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWF
ATTDWIAIYQRKVEAPFIPKCRGPGDTSNFDDYEEEDIRVSLTEKCAKEFADF
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggttatggaatacgtacccggtggagaaatgttttcacatctaagaagaattggaaga
ttcagcgaacctcatgcacggttttacgccgctcagatagtgctaacgtttgagtacctc
cactcgctagacctcatctacagagatctaaagcccgaaaatcttttaattgaccagcaa
ggatatatccaggtcacagactttgggtttgccaaaagagtaaaaggtagaacttggacg
ttatgcggcactccggaatatctagcaccggaaataattcttagcaagggctacaacaaa
gcggtggactggtgggcattaggagtgttaatctatgaaatggcagctggctatccccca
ttctttgcagaccaaccaattcaaatttatgaaaagattgtttctggaaaggtacggttc
ccatcccacttcagttcggatctgaaggacctgctaagaaacttgcttcaggtagacttg
accaagcgttacggaaatctcaagaatggtgtaaatgacataaagaatcacaagtggttt
gctactacagattggatcgctatttaccagagaaaagtagaagctccgttcataccaaag
tgcagaggccccggagacaccagcaactttgacgattatgaagaagaagacatccgtgtc
tctctaacagagaaatgcgcaaaagaatttgccgatttttag

DBGET integrated database retrieval system