KEGG   Ornithorhynchus anatinus (platypus): 100078999Help
Entry
100078999         CDS       T01045                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 4-like
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100078999
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100078999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 530 aa AA seqDB search
MSPKKPRRKRLPPNLMPNQPERRIFPPIQQTSPKQLRPNRSWQKKFNTSVGSFPPLDSSG
KASVSGSGKCRARAAPLPRGHGQSPRGAATFLLRSHGQSLRGAPSPTHQGHRVQSGQLLS
HLKMVESLPRPSPQNQAYKPDKTTHRPRPHKVPLTGTGVPAGGDLEGIGAGEGWRGHGRG
LVLHDHIAYRYEVLEMIGKGAFGQVAKCLDHKNDELVAMKIVRNKKRFHHQALTELKILD
ALRRRDRDHKGSMVHMKDHFYFRNHLCITFELLGINLYELLRNNGFQGLSLAVIRRFTYS
VLKCLQVLYMEKIIHCDLKPENIVLYQKGQISVKVIDFGSSCYEHQRVHTYIQSRFYRSP
EVILGRPYDTAIDMWSLGCILAELNTGSPLFAGENELEQLACIMEVLGLPPVHFIQTSSR
KQTFFDSEGFPKHITNHKGITHYPDSKNLATLLKTYDTDFLGFLQGCLIWDPSLRMTPEQ
ALRHAWILTPKWRAAKPSLQPSRKTNPGLSSVVKGMAWITGSSINGCCIY
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagtcccaaaaagcccaggaggaagcgcctgccccccaacctcatgccgaaccagccc
gagaggagaatcttccctccgatccagcagacgtcacccaaacagctgcggccgaacagg
tcctggcagaagaagttcaacacgagcgtgggctccttcccgcccctggactcgtcgggg
aaggccagcgtgagcggttccgggaagtgccgggcccgggccgcccccctcccccggggc
cacggccagagcccacggggcgccgccaccttcctcctccggagccacggccagagcctg
cggggtgccccctccccgacccaccagggacatagagtgcagagcggtcagctgctctct
cacctcaagatggtggaaagccttcccaggcccagcccccaaaaccaggcatacaagccg
gacaagaccactcacaggcccagaccccacaaggtgcctctgactgggacaggtgtgccc
gctggcggggacctggaggggatcggggcaggggaaggctggcgggggcatggaaggggt
ctggtcctgcacgaccacatcgcttaccgctacgaggtcctggagatgatcggcaaaggg
gccttcgggcaggtggccaaatgtctggatcacaagaacgacgagctggtggccatgaag
atcgtccgaaacaaaaagagattccaccaccaggctctgacggagctgaagatcctggac
gctctgcgccgcagggatcgggaccacaagggcagcatggtgcacatgaaggaccatttc
tacttccgcaaccacctgtgcatcacctttgagctgctgggtatcaatttatatgagctg
ctgagaaacaacggattccagggcctcagcctcgctgtgattcgccgcttcacctactca
gtcctcaagtgtctgcaagtgctgtacatggagaaaatcattcactgcgacctgaagccc
gagaacatagtcctctaccagaaaggccaaatctccgtcaaagtcattgacttcgggtcg
agctgctacgaacatcagagagtgcacacttacatccagagccgcttctaccggtccccg
gaggtgatcctcggccgcccctacgacacggccatcgacatgtggagcctgggctgcatc
ctggccgagctcaacaccggctccccgctgttcgccggcgagaacgagctggagcagctg
gcctgcatcatggaggttctgggtctccccccagtccacttcattcagacttcgtccagg
aagcagacgttcttcgattcagaagggtttccaaaacacataaccaaccacaaaggcata
acccactacccggactccaagaatctcgccacgctgctcaagacctacgatacggatttc
ctgggcttcctgcagggctgtctgatatgggacccgagcctgcgtatgaccccggagcag
gccctccggcacgcctggatcctgacgccgaaatggcgggctgccaagcccagcctccaa
ccctcgaggaagaccaaccccgggctgtcttcggttgtcaaggggatggcttggataacg
ggttcatccatcaacggctgctgtatttattga

DBGET integrated database retrieval system