KEGG   Ornithorhynchus anatinus (platypus): 100079007Help
Entry
100079007         CDS       T01045                                 

Definition
neutrophil collagenase-like
Orthology
K01402  
matrix metalloproteinase-8 (neutrophil collagenase) [EC:3.4.24.34]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 437 aa AA seqDB search
MVFILHQNYLERFYNLRNMKWKFMKDGDAVVEKIEEMQEFFGLEVTGELDEATLEVMAKP
RCGVPDVALFEVLPGNPKWKSNALTYRILNYISDMSQADTDEAFKKAFQLWSNASPLTFS
KINEGDADIMIYFARRDHGDNSPFDGPNNILAHAFQPGRGIGGDAHFDADETWTKGSKGY
NLFLVAAHEFGHSLGLSHSTEPGALMFPTYAFSDPKTFSLSQDDINGIQSIYGLSPNSVQ
PTGSSAPKACDPRLTFDAITTLRGEIIFFKDKYFWRKHPQMTSVEFNSISLFWPTLPEGI
QAAFEDKENDVVFLFKDRQYWALSGYDVLPGYPRDISLFGFPRTIRKIDAAVSDSRTRKT
YFFVDQQYWRYDDQRKSMEEGYPKLIANDFLGIENKIDAVFQINRYFYFFTGPHQYVFDP
YSRRTIAIRRSNSWFNC
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggtctttatcttgcatcagaattatctagaacgtttctacaatctgagaaacatgaaa
tggaagtttatgaaggatggggatgcagtcgtggagaagatcgaagaaatgcaggaattt
ttcggcctggaagtgactggggaacttgatgaggcaacgctggaggtgatggcaaagccc
agatgtggggtgccagatgtggctctcttcgaggtcctgccgggaaaccccaagtggaaa
tccaatgcccttacttacaggatcctaaactacatctcagatatgtcccaagctgacaca
gatgaagcatttaagaaggcgtttcaactctggagtaatgcctcccccctgacgttctcc
aagatcaacgagggagatgccgacataatgatttattttgcccgtagagatcatggggac
aattcacctttcgatggacccaataacatcctggctcatgcatttcagccaggtcggggt
attggtggagatgcgcattttgacgcagatgagacttggactaaaggctctaaaggttat
aatttgttccttgtcgccgcccatgagtttggccattccctgggtctttcccactcaacc
gaacctggggcactgatgtttcccacctatgccttctcggatcccaaaacgttctctctt
tctcaggatgacattaatggtattcaatccatctatggtttatcacctaactctgtccaa
ccaacgggatcctctgcacccaaagcttgcgaccccagattgacatttgatgccatcacc
actctccggggcgaaattattttctttaaagacaaatacttctggcgcaagcatcctcag
atgacatcggtcgaattcaattccatttctctattttggccgacgctgccagaaggcatt
caagctgcttttgaggacaaggaaaatgatgtggtttttctctttaaagacagacaatac
tgggctctcagtggatatgacgtacttccgggttatcccagggacatatccctgtttggc
ttcccgagaaccattagaaaaattgatgccgctgtttctgatagtagaacaagaaagacg
tacttctttgtagatcaacagtattggagatatgatgaccagagaaaatcgatggaagaa
ggctacccaaagcttatagcaaatgacttccttgggattgaaaataaaatagatgcggtg
tttcagataaataggtacttctacttctttactggaccacatcaatacgtatttgatcct
tattcccggagaaccattgccattaggagaagcaatagttggtttaattgttga

DBGET integrated database retrieval system