KEGG   Ornithorhynchus anatinus (platypus): 100079007Help
Entry
100079007         CDS       T01045                                 

Definition
neutrophil collagenase-like
Orthology
K01402  
matrix metalloproteinase-8 (neutrophil collagenase) [EC:3.4.24.34]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.34  neutrophil collagenase
     100079007
Peptidases [BR:oaa01002]
 Metallo Peptidases
  Family M10
   100079007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 464 aa AA seqDB search
MKGFPFLLLLQAQFSHAFPAVSKMQEEEKMTFAVNYLERFYNLRNMKWKFMKDGDAVVEK
IEEMQEFFGLEVTGELDEATLEVMAKPRCGVPDVALFEVLPGNPKWKSNALTYRILNYIS
DMSQADTDEAFKKAFQLWSNASPLTFSKINEGDADIMIYFARRDHGDNSPFDGPNNILAH
AFQPGRGIGGDAHFDADETWTKGSKGYNLFLVAAHEFGHSLGLSHSTEPGALMFPTYAFS
DPKTFSLSQDDINGIQSIYGLSPNSVQPTGSSAPKACDPRLTFDAITTLRGEIIFFKDKY
FWRKHPQMTSVEFNSISLFWPTLPEGIQAAFEDKENDVVFLFKDRQYWALSGYDVLPGYP
RDISLFGFPRTIRKIDAAVSDSRTRKTYFFVDQQYWRYDDQRKSMEEGYPKLIANDFLGI
ENKIDAVFQINRYFYFFTGPHQYVFDPYSRRTIAIRRSNSWFNC
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaagggttttccatttcttttgctgctccaagcccagttctcccatgctttccctgca
gtgtccaaaatgcaagaggaggaaaaaatgacatttgctgtgaattatctagaacgtttc
tacaatctgagaaacatgaaatggaagtttatgaaggatggggatgcagtcgtggagaag
atcgaagaaatgcaggaatttttcggcctggaagtgactggggaacttgatgaggcaacg
ctggaggtgatggcaaagcccagatgtggggtgccagatgtggctctcttcgaggtcctg
ccgggaaaccccaagtggaaatccaatgcccttacttacaggatcctaaactacatctca
gatatgtcccaagctgacacagatgaagcatttaagaaggcgtttcaactctggagtaat
gcctcccccctgacgttctccaagatcaacgagggagatgccgacataatgatttatttt
gcccgtagagatcatggggacaattcacctttcgatggacccaataacatcctggctcat
gcatttcagccaggtcggggtattggtggagatgcgcattttgacgcagatgagacttgg
actaaaggctctaaaggttataatttgttccttgtcgccgcccatgagtttggccattcc
ctgggtctttcccactcaaccgaacctggggcactgatgtttcccacctatgccttctcg
gatcccaaaacgttctctctttctcaggatgacattaatggtattcaatccatctatggt
ttatcacctaactctgtccaaccaacgggatcctctgcacccaaagcttgcgaccccaga
ttgacatttgatgccatcaccactctccggggcgaaattattttctttaaagacaaatac
ttctggcgcaagcatcctcagatgacatcggtcgaattcaattccatttctctattttgg
ccgacgctgccagaaggcattcaagctgcttttgaggacaaggaaaatgatgtggttttt
ctctttaaagacagacaatactgggctctcagtggatatgacgtacttccgggttatccc
agggacatatccctgtttggcttcccgagaaccattagaaaaattgatgccgctgtttct
gatagtagaacaagaaagacgtacttctttgtagatcaacagtattggagatatgatgac
cagagaaaatcgatggaagaaggctacccaaagcttatagcaaatgacttccttgggatt
gaaaataaaatagatgcggtgtttcagataaataggtacttctacttctttactggacca
catcaatacgtatttgatccttattcccggagaaccattgccattaggagaagcaatagt
tggtttaattgttga

DBGET integrated database retrieval system