KEGG   Ornithorhynchus anatinus (platypus): 100079016Help
Entry
100079016         CDS       T01045                                 

Gene name
USP44
Definition
ubiquitin specific peptidase 44
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100079016 (USP44)
Peptidases [BR:oaa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100079016 (USP44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1525 aa AA seqDB search
MDKCKHVGRLRLAQDHSILNPQKWHCVDCNTTESVWACLSCSHVACGRYIEEHALKHFQE
SSHPVALEVNELYVFCYLCDDYVLNDNATGDLKLLRSTLSAIKSQNYDCTTRSGRILRSM
GASDDSYLSHGGAQALLRNEDQMFTALWHRRRTLMGKVFRFWFEQTPIGRKILEEERLQE
EAEAKREEVRKRRQELKRQLKAEMERLPPRKSSRLQCQATSAFENAASPHAPASPAKQNE
LSTSDEIRPKKIGESPIKRRPTVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQCFLKLD
LNQTQELLATAASGKTRSSCKHPSVSDSVIPMQENPEKVTGSPLSRRPSLSSGLSGGASK
SRNMELIQPREPSSKYISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRGYAQQ
DAQEFLCELLDKVQHELEATGTRYPALIPSSQRKLIKRVLNVVNTIFHGQLLSQVTCLAC
DNKSNTVEPFWDLSLEFPERYHCNGKEMVSQYPCLVTEMLAKFTETEALEGRIYACDQCN
TKRRKFSSKPVILTEAQKQLMVCRLPQVLRLHLKRFRAQGKMERMERKPMGSALEIGPLY
FFDQLQTKAQEKSKKIPKELCIAFKYLIPGPHFAATIERPSKFMKSEEQKEGVLFQQETP
RKKKHLIPSSTLETNEEDSKPSQIPPVTTEDADLPMSLFDEYRFASSAILKELGQMLHFF
ADRHITFPQGIANLVNYSWKELTEGAVYRSTQHETLADKKERSLKGRGSVTGDKVPLGTE
HLRPEVTENARGQVKKYIFIGGEKDKSNHDNASKKILANKGPVPQSTNFPVKIRFSMSSK
YCEEKGWIFQHSNSDAEAMELKALLVLEQRCDYRAGQKEMAKQQEAWIIFKLEFQLLKNQ
DWMYLVYNQIRNIPSSNDFVIHHLKFSNELSNELIKMARFQINLKHKLEFPHYANSSIIH
YLKPPPGFLSNSGEMPISSYPSGQLAICQSYSNLPAGGVYTNVFSDSLDHDVLGTFTPFG
YGSVSFPHSQIIAMMFNRRGGVLTSRRGETVREWKWPRVGKLDDPVFIQVNKYIAVKIAG
RFAVDLFYKWQGESLKLSVATAQDSGAPCFEVDQVVTSVKFIPKSLKEVHKLNRKKLREK
EAKKPNQESSDHSEPVKTLERPEVDGSLVNDCSAIRELRKLQKKIRSIVDDWIKHYRLAF
GIGSPQISRITDVPQGILRKCKVQPVRALPVAPMVQNEEEKVGDTEVPEAGNSLRQPMDC
FQPASARNMPTETSIRSHSLRLPLSYDNEKFWFTSHLTCPVVLRRTLRGEAGKVCKCSNQ
QIPYVTDLEYDHIINNQMSSPEQITVICVLATFQTEKDVMEDEVEELYRRKNKTRNMPCM
QSSSFPWWCWLMLQTIVDGKKSRLDSFRLLKYIIYPADEFRGQKGSLLVQRHNAAPGMFL
VPVDLNQMLRYSSLLFSTAFPGHFFFSVLDPRVSSVKSLDLQNQKLESFLSRKEGGKMEQ
KKIFTTTVDPADNYWIAANSLPARG
NT seq 4578 nt NT seq  +upstreamnt  +downstreamnt
atggataagtgcaaacatgttgggcgactgcggcttgcccaggaccattccatactcaac
cctcaaaagtggcattgtgtggactgtaatactacagagtcggtatgggcctgcctcagc
tgttcccacgtggcttgtggaaggtacatcgaagagcatgcactgaagcactttcaggag
agcagtcatcccgttgcattggaggtgaacgagctgtacgtgttctgttacctctgcgac
gactatgttctgaatgataatgcaaccggagacctgaaattgttgcgaagtacgctgagt
gcaatcaagagtcaaaattatgactgcaccactcgcagtggaaggattttgcggtctatg
ggggcaagcgatgactcttacctttcccatggcggtgcccaagctctgcttcgcaacgaa
gatcaaatgtttactgctctgtggcataggaggcgtactttaatgggcaaagtgtttcga
ttttggtttgaacaaactcccattgggagaaagatactggaagaagaaaggctgcaggaa
gaagcagaagccaaaagggaggaagttagaaaaagacggcaggagctgaagcggcagttg
aaagcagaaatggagcgattgcctccgaggaagagctctcgtttgcagtgccaagccaca
tcagccttcgagaatgcagcgtcacctcacgccccagcctcaccggcaaaacaaaatgaa
ctatctacctcagatgaaataaggcccaaaaagataggcgagtcgccaattaaacgaagg
ccgacggtgactcccggtgtaaccggattgagaaacttgggcaatacctgctacatgaat
tccgttctgcaagttttgagtcacttgctgatttttcggcagtgctttctaaagctcgat
ctgaaccagacccaagagttgctggctacagctgctagtgggaaaacgagatcctcttgt
aaacacccgtccgtctcagattcagtgattccaatgcaggagaacccagagaaagtgaca
ggctccccgctctccaggcgtccaagtttatcttcgggcttgagtggcggggcatcaaaa
agtagaaacatggaacttattcagcccagggagcccagttcgaagtacatttcactttgt
catgaactgcatactctcttccaagttatgtggtccggaaagtgggcactggtgtctcct
tttgctatgctccactcggtgtggagactgataccagcctttcgcggctacgcccaacag
gacgctcaggaattcctttgtgaacttttagataaagtacagcatgaattggaagcaact
ggtaccaggtaccctgctcttattccaagttctcaaaggaaacttataaaacgagttctg
aatgtggtcaataccatttttcacggacagcttctcagtcaggttacatgtcttgcatgt
gataacaagtcaaatacagtagaacctttctgggacctttcattggaatttccagaaaga
taccactgcaatggaaaagaaatggtctcccaatatccatgtttggttacggaaatgttg
gccaaattcacagaaaccgaagctttagaggggagaatttatgcgtgtgaccagtgtaac
acaaaacgtaggaagttttcctcaaagccagttatacttacagaagcacagaaacagctg
atggtctgtcgactacctcaagttctgagactacacctcaaacgattcagggcacaagga
aaaatggaaagaatggaaagaaagcccatggggtcggctttggagattggtcccttgtat
ttctttgatcagctgcaaactaaagcacaagaaaaatccaagaaaatacctaaagagctg
tgtattgcttttaaatatctgattccaggtcctcattttgcagccacaatagaaaggcca
agcaaatttatgaagtctgaagaacaaaaggaaggggttttatttcagcaggaaactccc
aggaagaaaaaacatctcattccatcttctactttagaaaccaatgaagaagattcaaag
ccttcccaaattcctccagtcacaacagaagatgcagacttgccgatgagcctatttgat
gaatacagatttgcttcttctgctatattgaaggaacttggacagatgttgcattttttt
gctgaccgtcacattactttcccccagggaattgcaaatttagtgaactatagctggaaa
gaacttactgaaggagctgtttatagatcaacacagcatgagactttagcagacaaaaag
gaaagatccttgaaaggcagaggttcagtaactggagataaggtgcccctgggaactgaa
catctaagacctgaagtcactgaaaatgcaagaggtcaggtcaagaaatatatttttatt
ggaggagaaaaggacaaaagtaatcatgacaatgcctcaaaaaaaatcctagcaaataaa
ggtcctgttcctcagtctaccaactttccagttaaaatacgtttctcaatgtcatcaaaa
tactgtgaagaaaaaggttggatctttcagcatagcaactctgatgctgaagctatggaa
ttgaaggcactccttgtcttggagcagagatgtgactacagggcaggtcagaaggagatg
gcaaagcagcaagaggcctggataatcttcaaattggagtttcagctcctgaaaaatcaa
gactggatgtacttggtctacaaccaaatcagaaacattccctccagtaatgactttgtc
attcaccaccttaaatttagcaatgagctgtccaatgaactcattaaaatggccaggttc
caaataaatctgaagcataagctggaattccctcattatgccaactcttccattattcac
tacctgaaaccaccaccaggtttcttaagtaattcaggagaaatgccaatttcaagctat
ccctcaggccagctagctatctgccagagctattctaacctccctgccggcggtgtgtac
accaatgtattcagtgattcactggatcacgatgtgcttgggacctttactccttttggt
tatggcagtgtctcctttcctcacagtcaaataatagcaatgatgtttaatcggagggga
ggtgttttaactagtagaagaggagaaaccgtgagagaatggaaatggcctcgagtggga
aagcttgatgatccggttttcattcaggttaataaatatatcgcagtgaagattgctggg
cgatttgctgttgatttgttctacaagtggcagggtgaaagcttaaagttgtctgtggca
acagctcaagattcaggtgctccatgctttgaagtggaccaggtagtcaccagtgttaaa
tttatacctaaatcacttaaggaagtacacaaactaaacagaaagaaattaagagaaaaa
gaagcaaagaagcctaaccaagagtcatctgaccattcagaaccagtgaagacattagag
agaccagaagtggatggaagccttgtaaatgactgcagtgccataagagaattaagaaag
ttacaaaaaaaaatcaggagcattgtcgacgactggattaaacactatcgcctggcattt
ggcataggatcccctcagatttcccgaattaccgatgtcccacaaggaattcttagaaaa
tgcaaagtccaaccagtaagggcactaccagttgcacctatggtacaaaatgaagaagaa
aaagttggagacactgaggttcctgaagcagggaactccctccgacaaccgatggactgc
ttccaaccagcctctgctcggaatatgccaacggagaccagcatcagatctcattccctc
aggcttcctctttcctatgacaatgagaagttttggttcacctctcacctgacctgccca
gtggtactccgcagaacattaagaggagaggcagggaaggtgtgcaaatgcagcaatcag
cagattccatatgtgacagacctggaatatgatcacattattaataaccagatgtcctcc
ccggaacagatcactgtcatctgtgtactggccacttttcaaacagaaaaagatgtaatg
gaagatgaggtagaagagctatataggcggaagaacaaaaccagaaacatgccctgcatg
cagtcatcttcttttccttggtggtgttggctcatgttgcaaactatagttgatggcaaa
aaaagtcgcctggattcttttcgtttgctcaaatatatcatctatcctgcagatgaattc
agaggtcagaaaggctcactcctggtccagagacacaatgctgctccaggcatgtttttg
gttccagtagacctaaaccagatgctcagatattcttccctcctcttcagtactgccttt
cctggacatttcttcttttcagtcctggatcccagagtttcctcagttaaaagcctagac
ttgcagaatcaaaagctggaatcttttttaagtagaaaagaaggtggaaaaatggaacaa
aagaaaatattcacaacgacagtggatcctgcagacaattactggatcgctgctaactca
ctaccagctagaggttaa

DBGET integrated database retrieval system