KEGG   Ornithorhynchus anatinus (platypus): 100079281Help
Entry
100079281         CDS       T01045                                 

Definition
aldose 1-epimerase-like
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:oaa00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:oaa00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 360 aa AA seqDB search
MCDFISKRGPAEEVPKWCGQWLQVTMKICWDSDGEPTPHLSVHPIGQTNSLSLMVHQLMQ
VKVQLRRISWDKVAKTTSSVQPLSFTFHHVVEIIDPSTLYINGYLGSWQQPYLGAVIGRV
ANRIAKGKFSLNGREFQLAINKEPNSLHGGNRGFDKFLWSAQELPNGVQFFRISPDGEEG
YPGELKVWVTYTLDGGELAVNYRAQTNKPTPVNLTNHTYFNLAGQGSPNIYDHKVSIEAD
EYLPVDDTLVPTGEVAPVQGTAFDLRKPVNLGEQMKKFQIDGFDHNFCLKKTNKKHFCAR
PPGFDFSPVSLNLDFFRFTEPGNHTIPVPVLRQVSGFSRSFSVVSAGLSPPKESGLSSPV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgattttatcagcaagaggggcccagctgaagaagtcccaaagtggtgtggccag
tggcttcaggtcaccatgaagatatgctgggacagtgatggagagccaactccgcatctc
agcgtccatcccataggtcagacaaacagtttatccctcatggttcatcagctaatgcag
gtgaaagttcagctcagaagaatatcatgggacaaagttgctaaaaccacttcgagtgta
caacctctttccttcacatttcaccatgtagttgaaattatagacccttcgacactttac
attaacggctatctcggcagttggcaacagccttatttgggagcggtaattgggcgagtt
gcaaaccgcattgccaaaggaaagttttctctgaacggaagagaattccagcttgccatc
aacaaggaacccaactccctgcatggagggaatcgaggatttgacaagttcctgtggagc
gcgcaagagttgcccaatggtgttcagttcttccggatcagtccagatggcgaggagggc
taccctggggagctgaaggtttgggtgacgtacacgctcgacggaggggagttggcagtg
aactacagagctcagaccaacaagcccacgcctgtcaacctgaccaaccatacctatttt
aacttggccggtcagggttccccgaatatatacgatcacaaggtttctatcgaagccgat
gagtacttgcccgtagatgatactctggttcctacaggagaggttgctcccgtgcaggga
actgcctttgatctgagaaaacctgtgaaccttggagagcagatgaagaagtttcagatt
gatggctttgatcacaacttctgcctgaagaaaaccaacaaaaaacatttctgtgcaagg
ccacccggcttcgacttttctccggtgtccctgaatttagactttttcaggtttaccgaa
ccaggcaaccacacgatccccgtcccggtgcttagacaagtttctgggttttccagaagt
ttctccgtggtttctgctgggctgtcacctccaaaagagtcaggcctgagctctcccgtt
tga

DBGET integrated database retrieval system