KEGG   Ornithorhynchus anatinus (platypus): 100079281Help
Entry
100079281         CDS       T01045                                 

Gene name
GALM
Definition
galactose mutarotase (aldose 1-epimerase)
Organism
oaa  Ornithorhynchus anatinus (platypus)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 792 aa AA seqDB search
MKGEGVSGKRKDVKVQLRRISWDKVAKTTSSVQPLSFTFHHVVEIIDPSTLYINGYLGSW
QQPYLGAVIGRVANRIAKGKFSLNGREFQLAINKEPNSLHGGNRGFDKFLWSAQELPNGV
QFFRISPDGEEGYPGELKVWVTYTLDGGELAVNYRAQTNKPTPVNLTNHTYFNLAGQGSP
NIYDHKVSIEADEYLPVDDTLVPTGEVAPVQGTAFDLRKPVNLGEQMKKFQIDGFDHNFC
LKKTNKKHFCASSHSEYSLLAFPEWEGDMAFAKIEPGSDDEDNFEDAFENIPVATTMDLS
TALEESTVALCLFLNNRFSDALNFLRPWYKRSMYHATGYGFILVLRALMTFETQDIQQGI
EIMKEAMKTCQSFRRKSSLVQTLSHIIFKPNMESIGEVELHAEICYAECLLLKAGLALIE
DETMLSFIKGGVSFGTSYHIYRDCQEAILKIKSFHQTKAFKHLERGVKFGIGAFNLLLSL
LPESALRLLNFVGYTGDRDLGLALLHQGAVGTSVRAIMCILTLQIYYNYLYEWREIHHLC
YWELMWTYIFEQDWHYAYHYVDLLHQHNKWSKSMFTFLKASILCMLPGDFATAMGEDVKS
LFMQVRTQKQKIGGKTPPTDKFADVKCRRYYSTTSWHVAQPILEMMYIWSGFQVIAKRLD
LVARWMQVIETEEEVLHERPNLEYFMDDQCLVKLLKGCCLKYLDRLWKAELCFDHVIQNE
KLLKFDHYLVPYAYYELGILFHQKGDDEKALTYIEHAKTYRDFAMESRLQFRVHTALQRI
CGNLAKDVNPDF
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgaagggggaaggagtttcaggcaaaaggaaggatgtgaaagttcagctcagaagaata
tcatgggacaaagttgctaaaaccacttcgagtgtacaacctctttccttcacatttcac
catgtagttgaaattatagacccttcgacactttacattaacggctatctcggcagttgg
caacagccttatttgggagcggtaattgggcgagttgcaaaccgcattgccaaaggaaag
ttttctctgaacggaagagaattccagcttgccatcaacaaggaacccaactccctgcat
ggagggaatcgaggatttgacaagttcctgtggagcgcgcaagagttgcccaatggtgtt
cagttcttccggatcagtccagatggcgaggagggctaccctggggagctgaaggtttgg
gtgacgtacacgctcgacggaggggagttggcagtgaactacagagctcagaccaacaag
cccacgcctgtcaacctgaccaaccatacctattttaacttggccggtcagggttccccg
aatatatacgatcacaaggtttctatcgaagccgatgagtacttgcccgtagatgatact
ctggttcctacaggagaggttgctcccgtgcagggaactgcctttgatctgagaaaacct
gtgaaccttggagagcagatgaagaagtttcagattgatggctttgatcacaacttctgc
ctgaagaaaaccaacaaaaaacatttctgtgcaagttcccactccgaatactctcttcta
gcctttccggagtgggaaggagatatggcttttgcaaaaattgaaccgggaagcgacgac
gaggacaatttcgaagacgcctttgaaaatatcccagtagccaccacgatggatctttcc
actgccctagaagaaagcacggttgcactgtgcttattcctaaataaccgattctcagat
gctctcaatttccttcgcccgtggtataagcgaagcatgtatcatgccaccggctatggc
ttcatcttagtactgcgggctctcatgacctttgagactcaagacatccagcaggggatc
gagatcatgaaggaggccatgaagacctgtcagagcttcaggagaaaatcttcgctggtc
caaaccctgtctcatatcatcttcaaaccgaatatggagtccataggagaagtggaactg
cacgccgaaatctgttacgccgagtgtctgctcctgaaagcgggcctggcgttgatagag
gacgaaaccatgctgagttttatcaaagggggcgtcagcttcgggacgagttaccacatc
tatagagactgccaagaggccattctgaaaatcaaaagtttccaccagaccaaagccttc
aaacacctggagagaggggtgaagtttggcatcggcgcattcaatctgttgctgtccctt
ttacccgagagcgcccttcgcttgctgaacttcgtcggctacaccggggacagagattta
ggtctcgccctgctccaccaaggagcggtcgggaccagcgtcagggccataatgtgcatc
ttaaccttacagatctactacaattacctctacgaatggagggagatccatcacctctgt
tactgggagctgatgtggacctacatttttgagcaagactggcattacgcctatcactac
gtggacctacttcaccaacataacaagtggtccaagtcgatgttcaccttcctcaaggct
tccattctgtgtatgcttcccggcgacttcgccacagccatgggcgaggacgtcaaatct
ctgtttatgcaggtgaggacccagaagcaaaaaatcggggggaaaactcccccgaccgat
aagtttgccgacgtcaagtgcaggcgctattacagtaccacctcctggcacgtcgcccaa
ccgatcctggagatgatgtacatctggagcggtttccaagtgatagccaagagactcgac
ttggttgcccgctggatgcaggtcatcgaaacagaggaggaggttctacacgagcgtccc
aacctagagtactttatggatgaccagtgtttggtgaagctcctgaaaggttgctgcctc
aagtatctggaccgactctggaaagccgagctgtgcttcgatcacgtcattcaaaatgag
aaactgttgaagttcgatcactacctggtgccctacgcctactacgaactgggaatactg
ttccatcagaaaggcgatgatgagaaagcactcacgtacatcgagcatgccaaaacctac
cgagactttgccatggagtcgaggttgcagtttagggttcacacagcccttcagcgtata
tgtgggaatctagcgaaggatgtgaatccggacttctga

DBGET integrated database retrieval system