KEGG   Ornithorhynchus anatinus (platypus): 100079369Help
Entry
100079369         CDS       T01045                                 

Gene name
LYZ
Definition
lysozyme
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    100079369 (LYZ)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100079369 (LYZ)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100079369 (LYZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 148 aa AA seqDB search
MKPLFVLGLLVLPFLAHGKVFERCELARLLKRMGMDGYRGVSLPNWVCLANWESSFNTNA
KNYNPGDGSTDYGIFQINSRYWCNDGKTPRAVNACGISCNELLKDDITQAVRCAKRVVED
PQGIRAWVAWRNRCQGQDVSIWTRGCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctctctttgtgctgggactcctcgtccttcccttccttgcccatggcaaggtt
ttcgaaaggtgcgaactcgcgaggcttctgaagagaatgggaatggatggctacagggga
gtgtctctgccaaactgggtctgtttggccaactgggagagcagcttcaacacgaatgca
aaaaactacaaccctggcgacggaagcaccgattatgggattttccagatcaacagccgc
tactggtgcaacgatggcaagaccccgagagccgtgaacgcctgcggcatctcttgtaac
gaattgttgaaagatgatattacccaagcagtccgatgtgccaagagagtggtggaggat
ccccaaggcatcagggcatgggttgcatggagaaacagatgccaaggacaggatgtgtcc
atctggacccgtggctgtggagtgtaa

DBGET integrated database retrieval system