KEGG   Ornithorhynchus anatinus (platypus): 100079382Help
Entry
100079382         CDS       T01045                                 

Definition
liver carboxylesterase 1-like
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:oaa00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 621 aa AA seqDB search
MAEKIYGTHNLANNSIPCEHESCPFHAHGSYMYSLELLKWGLSLDPAVKGLRGEREYGCK
IQGGHGGRLVWGQKAKHDAEQPVVDTKYGKVQGKRVDIQGIDKPVGVFLGIPFAKPPLGE
LRFAPPQPAVPWNYVKEACSYPPMCIQEPVNGQVLSDLFTNRKENISLTFSEDCLYLNIY
TPADLTKSTKFPVMVWIHGGGLVVGGASTYDGLVLSAFENVVVVTIQYRLGIFGFFSTGD
EHAQGNWGYLDQVAALQWVQENIANFGGDPDLVTIFGESAGAVSVSALVLSPLAKNLFHR
AISESGSVLLPVLFNRNIKPVAKKMATVAGCKTTTSASMVHCLRQRTEEEILETTIKMDL
FKLDFQGEPTKSTLFVAAVVDGVFFPKSPEELLAEKKFNPVPYIIGINNNEFGWLLPTMM
QYPLSENQLDRDSVSSLLWSSFPLTNISKDRVPAVVEEYLGVTDDPARNKLLFLDMLGDL
IFGIPSVRTARFHRASGAPTYMYEYQHRPSSSMGLKPDYVQADHGDELNFVFGGPFLKGG
ASVEESKLSRTVMKYWSNFARNGNPNGEGLVTWPAYDQREEYLQIGLTQKVGEKLKDKRV
AFWTKIMREDHSGVKKRRTEL
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaagatctacggaacacataatctcgcaaataattccataccgtgtgaacat
gaaagttgtcctttccatgctcatggaagctacatgtatagcctcgagctgctgaagtgg
ggtttgtccctggacccagctgttaaaggtctcaggggtgagagagaatatggctgcaag
attcagggaggtcacggaggaaggctagtgtggggccagaaagcaaaacacgatgcggag
caacctgtggtggacaccaaatatgggaaagtccaaggaaagcgagtggacatccaaggg
attgacaaaccagtcggggtcttcctgggaatcccctttgccaagccccccctgggggag
ctgagattcgctcccccacaaccagctgtgccctggaactatgtgaaggaagcctgttct
tacccacctatgtgcattcaagagccagttaacggccaggtgctgtcagaccttttcaca
aacagaaaagaaaatatctccctcacattttcagaagactgcttgtacctcaatatttac
actccagctgacctgacaaagagcaccaagtttccagtgatggtgtggatccacggaggg
ggtttagtggtgggtggagcttcaacctatgatggcttagtgttatctgcctttgagaat
gtggtggtggtgaccattcagtaccgactgggcatctttggattcttcagcactggagat
gaacatgctcaagggaactggggctatctggaccaagtggcagccttgcagtgggtccag
gagaacattgccaattttggaggagacccagacttggtgactatctttggggaatctgct
ggagctgtcagcgtttctgctcttgttttgtctcctctggccaagaacctcttccaccgg
gctatttccgagagcggctccgtcctcctacctgttttgtttaaccgtaacattaaacca
gtagcaaaaaaaatggccaccgtcgctggatgtaaaaccaccacatcggcatccatggtt
cactgtctgcggcaacggacggaggaggagatcctggaaaccacgataaagatggattta
ttcaaattagactttcagggagagcccaccaagagcaccctatttgtggctgcagttgtg
gatggagtatttttccccaagagtcctgaagagctactggctgaaaagaaattcaatcct
gttccctatatcatcggaataaataataatgaattcggctggctacttccaactatgatg
cagtatcctctctctgagaaccagctagaccgggactcagtatcctcgttactgtggagt
tcattccctctcacgaacatctctaaggaccgtgtgcctgctgtagttgaggaatatctt
ggagtcacagatgaccctgccagaaataaactcctgttcctcgacatgttgggtgacctg
attttcggtatcccgtctgttcgaacagcccgtttccacagagcttccggcgcccctacc
tacatgtatgaatatcagcatcggcctagttcatctatgggacttaagccagattacgtc
caggctgaccatggagatgagttgaactttgtctttggaggcccgtttttaaaaggtggt
gcctcggtggaggagagcaaactcagcaggacagtgatgaaatattggtccaactttgct
cggaatggaaaccccaacggggaagggctggtgacctggcctgcctatgaccagagagaa
gagtacctgcagattgggctcactcagaaggtgggagaaaaactgaaggacaagcgagtg
gcgttctggaccaagatcatgagggaggaccactcgggggtgaagaaaaggcgcactgag
ttataa

DBGET integrated database retrieval system