KEGG   Ornithorhynchus anatinus (platypus): 100079460Help
Entry
100079460         CDS       T01045                                 

Definition
carboxypeptidase A1-like
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    100079460
   04974 Protein digestion and absorption
    100079460
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     100079460
Peptidases [BR:oaa01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   100079460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 376 aa AA seqDB search
HFYLGPGQLDFWRGPANPSSPIDVRVPFISIQAVKIFLESNGIQYSTMIEDVQMLLDEEQ
EQMLAFQSRARSTDTFSYATYHNLDEIYTFMDMLVAENPQLVSKIHIGSSYEGRPINVLK
FSTGGTNRPAIWIDTGIHSREWVTQASGIWFAKQISERSDPALNAILDTMDIFLEIVTNP
DGFAFTHSKNRLWRKTRSVNAGSSCIGVDPNRNWDAGFGTTGSSNNPCSETYRGKHANSE
VEVQSIVNFVKGHGNIKAFISIHSYSQLLLYPYGYTSVRAADYKELDDLAKASVTALASL
YGTKYRYGSIITTIYQASGGTIDWTYDSGIKYSFTFELRDTGRYGFLLPANQIIPTAQET
WLALMTIMKHVHAHPY
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
catttctaccttggtcctgggcagctggacttctggcgagggcccgccaacccctcctct
cccatcgacgtgcgagtgcccttcatcagcatccaggccgtcaaaatcttcctggagtcc
aacggcatccagtactccaccatgatcgaggacgtgcagatgctgctggatgaggaacaa
gaacagatgttggccttccagtctcgtgcccgctccaccgacaccttcagttacgctacc
taccataacctggacgagatctacaccttcatggacatgctggtggccgagaacccccag
ctcgtcagtaagattcacatcggcagcagctacgagggccggcccatcaacgtcctcaag
ttcagcaccgggggtaccaaccgccccgccatctggatcgatactggcatccactcccgc
gagtgggtcactcaggccagcggcatctggtttgccaagcagatcagcgagagaagtgac
ccagccctcaatgccatcctagacaccatggacattttcctggagattgtgaccaaccct
gatggctttgccttcacccactctaagaaccgactgtggcgtaagacccggtcagtcaac
gctggctcatcctgcatcggggtggaccccaacaggaactgggacgctggctttggaacg
accgggtcgagcaacaacccgtgctcggagacctaccgaggcaagcacgccaactccgag
gtggaggtccagtccatcgtgaacttcgtgaagggccatgggaacatcaaggccttcatc
tccatccacagctactcccagctcctcttgtacccctacggctacaccagcgtccgggct
gctgactataaggagctggatgacctggccaaggcctcggtgaccgccctggcttctctc
tatgggaccaagtaccgatatggcagcatcatcaccaccatctaccaggccagcggcggc
accattgactggacctatgactcgggcatcaagtattccttcaccttcgagctgagggac
accggccgctacggcttcttgctgccggccaaccagatcatccccacggcccaggagacg
tggctggccctcatgaccatcatgaagcacgtccacgcccacccctactga

DBGET integrated database retrieval system