KEGG   Ornithorhynchus anatinus (platypus): 100079606Help
Entry
100079606         CDS       T01045                                 

Gene name
USP32
Definition
ubiquitin specific peptidase 32
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1718 aa AA seqDB search
MEVEWIFGFRSHTKDGGGWICGFEVPRSQEPPHLFQWSGCLISEATPSTAKDGFVVLKYL
DPGSLMNGKHAQGCTQIFSPFEIAYFIFVASLQDLNERPLTFYLILVSEGHTPLMRLNFL
SRASLRATPSEVTDVELKRLKDAFKRTCGLSCYMGQQCFIREVLGDGVPPKVAEVIYCSF
GGTSKGLHFNNLIVGLVLLTRGRDEEKAKYIFSLFSNESGSYVIREEMERMLHLVDGKVP
DSLRRCFSEGEKVNYEKFRNWLLLNKDAFTFSRWLLSGGVYVTLTDDSDTPTFYQTLAGV
THLEESDIIDLEKRYWLLKAQSRTGRFDLETFSPLVSPPIHPSLSEGLFNAFDENRDNHI
DFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSHTELRDMVVALLEVWKDNRTDDI
PELHMKLSDIVDSILNAHDTTKMGHLTLEDYQIWSVKNVLANEFLNLLFQVCHIVLGLRP
ATPEEEGQIIRGWLERESRYGLQPGHNWFIISMQWWQQWKEYVKYDANPVVIEPSSVLMG
GKNPLATTAQSLEPSEDKTGGAGLDYLNTTEEKFSDDISSASEASESASSTFLYSSTPAA
DMCFARQHNTSDNNNQCLLGANGNILLPFNPQKPGAIDNQPLVTQEPVKATSLTLEGGRL
KRIPQLIHGRDYEMVPEPVWRALYHWYGANLALPRPVIKNSKTNIPELELFPRHLLFLRQ
QPATRTQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLRIKEEDMR
LWLYNSENYLTLLDDEDHMLEYLKIQDEQHLVIEVRNKDMSWPEEMSFIANSSKIDRHKV
PTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKCY
GDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHEDLNRVHEK
PYVELKDSDGRPDWEVAAEAWENHLRRNRSIVVDLFHGQLRSQVRCKTCRHISVRFDPFN
FLSLPLPMDSYMHLEITVIKLDGTTPVRYGLRLNMDEKYTGLKKQLSDLCELKPEQILLA
EVHGSNIKNFPQDNQKVRLSVNGFLCAFEIPTPGSPTSASSPVQTDLPTSPSTTGILNAP
TNGDLPRPTLLPNGMPNTVVPCGTEKTFSNGMVNGHATILPGSPFIGYIIAVHRKMMRTE
LYFLSSQKNRPSLFGMPLIVPCTVHTRKKDLYDAVWIQVSRLASPLPPQEASNHAQDCDD
SMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCKIDCGEDSAYIGNAYIAVDWDPTALHLR
YQTSQERIVEEHESVEQSRRAQAEPINLDNCLRAFTNEEELGEDEMYYCSKCKTHCLATK
KLDLWRLPPILIIHLKRFQFVNGRWIKSQKIVKFPRENFNPGAFLVPRDPALCQRKTLPP
QGDDSCDPRPPPGELKKVESQNGFTPGEGDALCKSPSSLSTNIVNNTKGSPSSARKSGSS
CPSSKNSSPNGSPRTLGRSKGRLRLPQIGSRSKLSGSKENLDPSKENGADQSSESADGTS
RGHVLGESQPELFTPQDNEGPVANGFFWGQEASANSCSNGQMENYSEEDITDDQREDVCI
KPIYNLYAISCHSGILGGGHYVTYAKNPNNKWYCYNDSSCKELHPDEIDTDSAYILFYEQ
QGIDYAQFLPKIDGKKMADTSSMDEDFESDYKKYCVLQ
NT seq 5157 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggagtggatattcggtttccgaagccacaccaaggacggcggaggatggatt
tgtggttttgaagtacctagatcccaggagcctccacacctttttcagtggagtggatgc
ttgatttccgaagccacaccaagcacagctaaggatggatttgtggttttgaagtaccta
gatcccgggagtctcatgaatgggaaacacgcccagggctgtacgcagatttttagtcct
tttgaaatcgcgtatttcatttttgttgccagccttcaagatcttaatgaacgacccctt
acgttttatttaattctggtttctgagggtcacacacctcttatgcggcttaattttctc
tctcgcgcgtccttacgtgcaacaccctcggaagtaacagatgtggagttgaagcggctt
aaagatgccttcaagagaacctgcggactctcctgttacatgggccagcagtgcttcatt
agggaagttcttggagatggcgttccacccaaggttgctgaggtgatctactgttcgttt
ggtggaacatctaaagggctacacttcaataacttaattgttggacttgttctcctcaca
agaggcagagatgaagagaaagcgaaatacatttttagtctgttttctaacgaatctgga
agctatgtcatccgggaagaaatggagagaatgctccacttggtggatggaaaagtccca
gattcactcaggagatgtttctctgagggtgaaaaggtgaactacgagaagtttagaaac
tggttacttctaaacaaagacgctttcactttctccagatggctgctctctggaggtgta
tatgtaacgctcacagatgatagtgataccccaactttctaccaaactctggctggagtc
acccatttagaagaatctgacatcatcgatctcgagaagcgctattggctgctgaaggct
cagtcccggaccggccgttttgacctggagacatttagccctttggtttcgccacctatt
catccgtcgctgagtgaaggtttgtttaatgcctttgatgaaaaccgtgacaatcacata
gactttaaggagatctcctgtgggttatcagcatgttgcaggggacccttggccgaaaga
caaaaattttgcttcaaagtatttgatgttgatcgtgatggagttctctctcacactgaa
ctgagagatatggtggttgcacttttggaggtttggaaggataaccgcactgatgacatc
cctgaattgcacatgaaactgtctgacatagtagacagcattttgaatgcccacgacacc
acgaagatggggcatctcactctagaggactatcagatctggagtgtgaagaatgttctt
gccaatgaattcttaaacctccttttccaggtgtgccatatagttttgggtttaagacca
gctactccagaagaagaaggacaaataatcaggggttggctcgaacgggagagtaggtac
ggcctgcagccgggacacaactggttcatcatctctatgcagtggtggcagcagtggaaa
gaatatgtcaaatatgatgccaaccctgttgtgatcgaaccttcgtctgtcttgatgggg
gggaaaaacccactcgccacaacagctcagtctctggagccgagtgaagacaaaacagga
ggtgctggccttgattatttgaatactacggaagagaagttttccgacgatatttcttct
gcgtctgaagcctcggagtcagctagcagcactttcctttattccagcactcctgcggca
gatatgtgttttgctaggcaacataacacttctgacaacaacaatcagtgtttgctcgga
gccaatggaaacattttactaccattcaacccacaaaaaccaggggctatcgataaccag
cctttggtaacccaagaaccagtgaaggcaacttcattaaccctggaaggcggaaggttg
aaacgaattccacagctaattcatgggagagactatgaaatggtgccagaaccagtatgg
agagctctatatcactggtatggagcaaacctggccttacccagaccagtgatcaagaat
agcaaaacaaacatcccggaattggagttgtttcctcgccacctcctcttccttagacag
cagcctgccactcggacacagcaatcgaacatctgggtgaatatggggaatgtgccttct
ccaaacgcacctttaaagagggtgttagcgtatacaggctgctttagtcgcatgcagacc
atcaaggaaattcatgagtatctgtcccagaggttgcgcatcaaagaagaagatatgcgc
ctgtggttatacaacagtgagaactaccttactcttctggatgatgaagatcatatgtta
gaatacctgaaaatccaggatgaacagcacttagtaattgaagttcgaaacaaggacatg
agctggccagaggagatgtcatttatagccaacagtagtaaaatagacagacacaaggtt
cccacggagaagggtgccacagggctgagtaacctgggaaatacatgcttcatgaactcc
agcatccagtgcgttagtaatacgcagcctctaactcagtacttcatctcaggaagacac
ctctacgaactcaacaggacaaatcccattgggatgaagggccacatggccaaatgctac
ggggatctggttcaggaattgtggagtggaactcagaagaacgtggctcccctaaagcta
cggtggacgatagccaagtatgctcctaggttcaatggtttccagcagcaggattcccag
gaacttctggcttttctcttggatggtcttcacgaggatctcaatcgagttcatgagaag
ccgtacgtggagctgaaggatagtgacggtcgcccagattgggaggtagcagctgaggcc
tgggaaaaccatctgagaagaaaccgatcaattgttgtggatttgttccacggccagcta
agatcgcaagtcagatgcaaaacctgtagacacataagtgttcgattcgaccctttcaat
tttctctctctgccactacccatggatagctacatgcatttagaaataacagttattaag
ctagatggtactacccctgttcgatacggactgaggctgaatatggatgagaagtacacg
ggcttgaaaaagcagctgagcgatctgtgcgaactgaagcccgaacagattcttcttgcc
gaagtgcatggctccaacataaagaactttcctcaggacaaccagaaggtacggctttct
gtgaatggctttttgtgtgcgtttgagatccccaccccagggtccccaacttcagcatcc
agccctgtccagacagacttacccactagtccgtcgacgactggaatcctcaatgcccca
accaacggggacctgccccgcccaacgctccttcccaatggaatgccaaacactgtcgtg
ccatgtggaactgagaagaccttctctaacgggatggtgaatggtcacgcgacgatactt
cccggaagccccttcataggctacatcattgcagtccacaggaaaatgatgagaacagaa
ctgtacttcctgtcatctcagaagaatcgccccagcctcttcggaatgccgttgatcgtt
ccgtgtacggtgcacacccggaaaaaagacctgtacgatgcagtgtggattcaggtgtcc
cgattggccagcccactccctcctcaggaagccagtaatcacgcccaggactgtgacgac
agcatgggttatcagtatccgtttacactaagggttgttcagaaggatgggaattcctgt
gcatggtgcccgtggtacaggttctgcagaggctgtaaaatcgactgcggagaagacagc
gcctacattggaaacgcttacattgctgtggattgggaccccacagcccttcaccttcgt
taccagacgtcacaagaacggattgttgaagagcacgaaagtgtggagcagagccggagg
gcccaggcagaacccatcaacctggacaactgtctgcgggccttcaccaacgaggaggag
ctgggcgaggacgagatgtattattgttccaagtgcaagacccactgtttagccaccaag
aagctggatctctggagactcccccccatcctgataattcacctaaaacgatttcagttt
gtgaacggccgctggatcaaatctcaaaaaatcgttaagtttcctcgtgaaaactttaac
cccggtgctttcctggtacccagagatccagcactttgccagcgcaagaccctcccgccc
caaggggatgactcgtgtgatcctcggcctcctccgggagaattgaagaaagtggagtcc
cagaacgggttcacacccggagaaggggacgcactgtgcaagagcccttcctctctcagt
accaacattgtcaataatacgaaaggctctccatcttcagcaaggaaaagcggaagcagc
tgcccctcgagcaaaaacagcagcccaaacggcagccctagaactttaggaaggagtaaa
gggcgactccgcctaccccagatcggcagcagaagtaaactgtccgggagcaaggagaac
ttggaccccagtaaggagaacggtgccgaccagtcttctgagtcggccgacggcacgagc
agaggacacgtgttgggggagagccagccagagttgttcacgcctcaggacaacgagggg
cctgtagccaacggattcttttggggacaagaagcgtccgccaacagctgtagtaacggt
cagatggaaaactacagtgaggaagacatcaccgatgaccaaagagaagacgtctgcatt
aagcctatttacaacctatatgcaatttcgtgccattcaggaattttaggcgggggtcat
tacgtcacttatgccaaaaacccaaacaataagtggtactgctataacgacagcagctgt
aaggaactccacccggacgaaattgacaccgactctgcttacattcttttctacgagcag
caggggatagactatgcacaatttctgccaaagattgacggcaaaaagatggcagacacg
agcagcatggacgaagacttcgagtccgactataagaagtactgcgtattacagtga

DBGET integrated database retrieval system