KEGG   Ornithorhynchus anatinus (platypus): 100079751Help
Entry
100079751         CDS       T01045                                 

Gene name
MTOR
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
EGFR tyrosine kinase inhibitor resistance
Endocrine resistance
ErbB signaling pathway
HIF-1 signaling pathway
Phospholipase D signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Jak-STAT signaling pathway
Insulin signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Insulin resistance
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Prostate cancer
Acute myeloid leukemia
Central carbon metabolism in cancer
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100079751 (MTOR)
   04630 Jak-STAT signaling pathway
    100079751 (MTOR)
   04066 HIF-1 signaling pathway
    100079751 (MTOR)
   04072 Phospholipase D signaling pathway
    100079751 (MTOR)
   04151 PI3K-Akt signaling pathway
    100079751 (MTOR)
   04152 AMPK signaling pathway
    100079751 (MTOR)
   04150 mTOR signaling pathway
    100079751 (MTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100079751 (MTOR)
   04920 Adipocytokine signaling pathway
    100079751 (MTOR)
   04919 Thyroid hormone signaling pathway
    100079751 (MTOR)
  Aging
   04211 Longevity regulating pathway - mammal
    100079751 (MTOR)
   04213 Longevity regulating pathway - multiple species
    100079751 (MTOR)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100079751 (MTOR)
   05230 Central carbon metabolism in cancer
    100079751 (MTOR)
   05231 Choline metabolism in cancer
    100079751 (MTOR)
   05206 MicroRNAs in cancer
    100079751 (MTOR)
   05205 Proteoglycans in cancer
    100079751 (MTOR)
   05214 Glioma
    100079751 (MTOR)
   05221 Acute myeloid leukemia
    100079751 (MTOR)
   05215 Prostate cancer
    100079751 (MTOR)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100079751 (MTOR)
   04931 Insulin resistance
    100079751 (MTOR)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100079751 (MTOR)
   01522 Endocrine resistance
    100079751 (MTOR)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100079751 (MTOR)
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   100079751 (MTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 2191 aa AA seqDB search
MEEKFNQVCIWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHVLSCVK
KEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAIQVDATVFTC
ISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSL
VLMHKPLRHPGMPKGLAHQLASPSLTNLPEASDVGSITLALRTLGSFEFEGHSLTQFVRH
CADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGIT
DPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAF
VMPFLRKMLIQILTELEHSGVGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKD
PDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVALWTLG
QLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGM
IDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLS
HHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREVEEPGERVQGRRDEL
DTQDLKFLFQQLGMLVSFVRSHIRPYMDEIVTLMREFWIMNSSIQSTIILLIEQIVVALG
GEFKLYLPQLIPHMLRVFMHDSSTGRAVSIKLLNAIQLFGANLDDYLHLLLPPIVKLFDA
PDAPLAARKAALETVDRLTESLDFTDYASRIIHPIVRTLDLSPELRSTAMDTLSSLVFQL
GKKYQIFIPMVNKVLVRHRITHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRTSQGET
LASGPVETGPMKKLHVSTINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCW
ALAQAYNPMARDLFNAAFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFM
EHSDKGPLPLRDDNGIVLLGERAAKCRAYAKALHYKELEFQKGPSPAILESLISINNKLQ
QPEAAAGVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCL
EALGEWGQLHQQCCEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGA
FYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCQMLSELEEVIQ
YKLVPERREIIRQIWWERLQGCQRIVEDWQRILMVRSLVVNPHEDMRTWLKYASLCGKSG
RLALAHKTLVLLLGVDPSRQLDHPLPTVHPQVTYAYMKHMWKSARKIDAFQHMQHFVQTM
QQQAQHAIAAEDQQHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSASTEHDR
NWYKAWHAWAVMNFEAVLHYKHQNQARDEKKKLRHASGASITSANTEGSNSESEAESGEN
SPIPSPVQKKVTEDLSKTLLLYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPD
VNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTV
ASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLY
FGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLT
QAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAP
SLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRK
NLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHL
TLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGD
RHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRI
TCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEML
DSVELGETAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDET
LDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 6576 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaagttcaatcaggtatgcatctgggtgctcaagtgcagaaacagtaagaac
tccctgatccaaatgaccatcctcaacctgctgcctcgcctggctgccttccggccttcc
gccttcacagacactcagtatctccaagacaccatgaaccacgtactgagctgcgtcaag
aaggagaaagagcgtacggcggcgttccaggccctggggctgctctccgtcgctgtgcga
tccgagttcaaggtctacttgccccgagtgctggacatcattcgagcggcccttcctccg
aaggactttgcccataagaggcagaaggccatacaagtggacgccaccgtgttcacgtgc
atcagcatgttggcccgagccatgggacccggcattcaacaggacatcaaagagctgctg
gagcccatgttggccgtggggctgagccccgccctgacggccgtgctgtatgacctgagc
cgccagatcccgcagctgaagaaggacatccaggacgggctgctgaagatgctgtccctc
gtcctgatgcacaaacccctccggcacccgggcatgcccaagggcctggcccaccagctg
gcctctcccagcctcaccaacctgcccgaggccagcgacgtgggcagcatcaccctggcc
ctccgcacccttggcagctttgagtttgaaggccactctctgacccaatttgtccgccac
tgcgcggatcacttcctgaacagtgaacacaaagagatccgcatggaggcggctcgcact
tgctcccgcctgctcaccccctccatccatctcatcagcggccacgcccacgtggtcagc
cagaccgcagtccaggtggtggccgacgtgctcagcaaactgcttgtggtggggatcacg
gacccggaccccgacatccgttactgcgtcctggcctccctggacgagcgcttcgacgcc
cacctggcccaggcggagaacctgcaggccctgttcgtggccctgaacgaccaggtgttt
gagatccgagagctggccatctgcaccgtgggccggctgagcagcatgaacccggccttc
gtcatgcccttcctgcgcaagatgctcatccagatcctgacggagctggagcacagcggg
gtgggcagaatcaaggagcagagcgctcgcatgctgggccacttggtctccaacgccccc
cgtcttatccgcccgtacatggagcccattctgaaggctttaatcttgaagctgaaagat
ccagaccctgatccgaacccaggggtgatcaataatgtcttggccacgataggggagctg
gcacaggtgagtggcctggaaatgaggaagtgggttgatgagctcttcatcatcatcatg
gatatgctccaggactcctctctgttggccaaaaggcaggtggctctgtggaccctggga
cagctggtggccagtactggctatgtggtggagccctacaggaaataccctaccctcttg
gaggtgctgctaaacttcctgaagacggagcagaaccagggaacccgcagagaggccatc
cgggtgttggggctgctgggcgctttggatccctacaaacacaaagtgaacatcggcatg
attgaccagtcccgagatgcttctgccgtcagcctgtccgagtccaagtctagccaggat
tcctccgactacagtaccagcgagatgttggtgaacatgggcaacctgccgctggatgaa
ttctaccctgccgtgtccatggtggccctgatgaggatcttccgagaccagtccctgtct
caccaccatacgatggtggtccaggccatcactttcatcttcaaatccctggggctcaaa
tgcgtgcagtttttgccccaggtcatgcccacattcctcaacgtgatccgggtctgcgac
ggggccatccgggaggtagaagagcccggtgaaagagtacaggggagaagagacgagttg
gatacgcaagacctaaaattcctgttccagcagctgggaatgttagtgtcctttgtgagg
agccacatcagaccctacatggatgaaatcgtcaccctcatgagagagttctggatcatg
aacagctcgatccagagcacaatcatcctcctcatcgagcagatagtggttgccctcgga
ggggagttcaagctttacttgccccagctgatcccccacatgttacgggtcttcatgcat
gacagcagcacaggacgcgccgtatccatcaagttgttgaacgccatccagctgttcggc
gccaacttggacgactacttgcatttgctgctgcctccgatcgtcaagctgttcgatgcc
cccgatgctcccctggcagctcgcaaggctgccctcgagactgtagaccgtttgacggag
tctctggatttcaccgattacgcctcccggattattcatcccatagtgcggacgttggat
ctgagcccagagctgcggtccactgccatggacactctgtcttcgctcgtcttccagctg
gggaagaagtaccagatttttatcccaatggtcaacaaagtcctagtgcggcatcgaatc
acccaccaacgctatgacgtgctcatctgcaggattgttaagggctacaccctggctgac
gaggaggaggaccctttgatttatcagcatcggatgctgaggactagccaaggggagacc
ctggccagcgggccagtggagaccgggcccatgaagaaactgcacgtcagtaccatcaac
ctgcagaaggcctggggagcggccaggagggtgtcgaaggatgactggttggagtggctg
aggcggctgagcctggaactgctgaaggattcttcgtcgccttcgctgcgctcctgctgg
gccctggctcaggcctacaaccccatggccagggacctcttcaatgccgcatttgtgtcc
tgctggtccgaactgaatgaagaccagcaagatgagctgattcgaagcatcgagctggcc
ctgacctcccaagacatagcggaagtcacgcaaaccctcctgaacctggctgaattcatg
gagcacagcgataagggcccgctgccactgagagacgacaacggtatcgtcctgctgggg
gagagagctgccaagtgccgagcgtatgccaaggcgttacactacaaagagctggagttc
cagaagggccccagccccgcaatcctagaatcgctcatcagtattaataataaactacaa
caaccggaggcagccgctggtgtgctggaatatgctatgaagcactttggagagctggag
atccaggctacctggtatgagaagctgcatgagtgggaagatgccttggtagcctacgat
aagaaaatggataccaacaaagatgaccccgagctgatgctgggccgaatgcgctgtctt
gaggccttgggagaatggggtcagctccatcaacagtgctgtgaaaaatggaccctggtg
aatgacgagacccaagccaagatggcccggatggccgccgctgccgcctggggattaggt
cagtgggacagtatggaggagtacacgtgcatgatcccccgggacacccacgacggggcg
ttttacagggccgtgctggcactgcaccaggacctcttctcattggcccagcagtgcata
gacaaagctagagacttattggatgccgagctgactgccatggcgggagagagctacagt
cgggcgtatggggcaatggtttcctgccaaatgctatcggagctggaggaggttatccag
tataaacttgtccccgagcgacgggaaatcatccgccagatctggtgggagaggctgcag
ggctgccaacggattgtcgaggactggcagagaatcctcatggtcaggtctctggtcgtc
aacccgcacgaagacatgagaacctggctcaagtatgccagcctttgtggcaagagcggc
agactggctctcgctcataaaaccctggtcttgctcttgggagttgacccttctcgacag
ctggaccatccgttgccaacggttcacccgcaagtgacctacgcgtacatgaagcacatg
tggaagagcgctcgcaagatcgacgccttccagcacatgcagcactttgtccagacgatg
cagcagcaggcccagcacgccatcgccgccgaggaccagcagcataagcaggagctccac
aaactcatggcccgctgtttcctgaaactgggagaatggcagctgaacctgcaaggcatc
aacgaaagcacaatccctaaagtcctccagtattacagtgcctctaccgagcatgaccgc
aactggtataaggcctggcacgcctgggcagtgatgaactttgaggccgtgctgcactat
aagcatcaaaaccaggcccgagatgaaaagaagaaactgcgccatgccagtggagccagc
atcaccagcgcaaacaccgaggggagtaacagcgagagcgaggcagaaagcggcgagaac
agccccattccatctcccgtgcaaaagaaagtcactgaggatctgtccaagacgctgttg
ttatacaccgttcctgccgtccagggtttcttccgctccatctctctgtcccggggcaac
aatcttcaggacacactcagagtcctcactttgtggtttgactatggtcactggccagat
gtcaacgaagccctggtagaaggtgtgaaggcgatccagatcgacacctggttacaggtt
atcccccagctcattgcaagaatcgatactccccggcccctggtgggacgcctgattcat
cagctcctcacggatattggccgatatcatccgcaggctctgatctacccactgaccgtg
gcatccaagtccaccaccactgcccgtcacaatgcagccaacaagatcctgaaaaacatg
tgtgaacacagcaacaccctggtccagcaggccatgatggtgagcgaggagctgatccgg
gtggccatcctgtggcacgagatgtggcacgagggcttggaagaggcttcccgcttatat
ttcggggagaggaacgtgaaagggatgtttgaggtcctggagccactgcacgctatgatg
gagcggggaccccagaccctgaaggaaacgtcgttcaatcaggcatatggtcgggatttg
atggaggctcaagagtggtgccggaagtacatgaaatctgggaacgtcaaggacctaacg
caggcctgggatctctattatcacgtgttcaggaggatctcaaaacagctacctcagctt
acttccttggagttgcagtacgtgtcccccaaactcctgatgtgccgggaccttgaatta
gccgtgccgggaacctacgatcccaaccagcccatcatccgcattcagtccatagcacct
tctttgcaggtcatcacatccaaacaaaggcccaggaagttgacattaatgggcagcaac
ggccatgagtttgtcttccttctgaagggccacgaggacctccgacaggacgaacgggtg
atgcagctctttggtctggttaacacccttctggccaacgacccgacctctctgcggaaa
aatctcagcatccagaggtacgccgtcattcccttatctaccaattcaggcctaattggc
tgggtcccccactgcgacactttgcacgcgctcatccgggattacagggagaagaagaag
atccttcttaatatcgagcatcgcatcatgttgcggatggctccagattacgaccacttg
actctgatgcagaaggtggaggtatttgaacacgccgtcaataacactgcaggagatgat
ctagccaaactgctgtggctaaaaagccccagctctgaggtgtggtttgaccgaagaacc
aattacacccgttctttagctgtcatgtcgatggttgggtatattttgggcttaggagac
aggcacccatccaacctgatgctggacaggctaagcggaaagatcctgcacattgacttt
ggagactgttttgaggttgcgatgaccagagagaagttcccagagaagattccatttaga
ctgacgagaatgttgaccaatgcaatggaggtgactggcctcgacggaaactacagaatc
acctgtcacaccgtaatggaggttctccgtgaacacaaagacagtgtgatggcggtgctg
gaagccttcgtttatgaccccttattgaactggaggctgatggatacaaacacaaaaggc
aataagcgatcacgaacaaggacagactcctactcagccggccagtctgtagaaatgctg
gatagtgtggagcttggcgaaaccgcccacaagaaaactgggaccacagtgcctgaatcc
atccattctttcattggtgacggtttggtgaaaccagaagctctgaataagaaagctatt
cagattattaatagggttcgagataaactcaccggtcgggatttctctcacgacgagacc
ttggatgttcccacacaagtggagctgctgatcaagcaggcgacttcccatgagaacctg
tgtcagtgctacattggctggtgtccattctggtaa

DBGET integrated database retrieval system