KEGG   Ornithorhynchus anatinus (platypus): 100079751Help
Entry
100079751         CDS       T01045                                 

Gene name
MTOR
Definition
mechanistic target of rapamycin (serine/threonine kinase)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
ErbB signaling pathway
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Prostate cancer
Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100079751 (MTOR)
   04066 HIF-1 signaling pathway
    100079751 (MTOR)
   04151 PI3K-Akt signaling pathway
    100079751 (MTOR)
   04152 AMPK signaling pathway
    100079751 (MTOR)
   04150 mTOR signaling pathway
    100079751 (MTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100079751 (MTOR)
   04920 Adipocytokine signaling pathway
    100079751 (MTOR)
   04919 Thyroid hormone signaling pathway
    100079751 (MTOR)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100079751 (MTOR)
   05206 MicroRNAs in cancer
    100079751 (MTOR)
   05205 Proteoglycans in cancer
    100079751 (MTOR)
   05214 Glioma
    100079751 (MTOR)
   05221 Acute myeloid leukemia
    100079751 (MTOR)
   05215 Prostate cancer
    100079751 (MTOR)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100079751 (MTOR)
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [Table]
   100079751 (MTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2356 aa AA seqDB search
MSQEESTRFYDQLNHHIFELVSSSDANERKGGILAIAGKHRASTVRHTYEEAEKGFDETL
AKEKGMNRDDRIHGALLILNELVRISSMEGEVCGQPLAGGAPRRALRFLERLRERALLPA
SWALAEIRGPPRHITPFTSFQAVQPQQSNALVGLLGYSAHQGIVGFGASPIPVKSTLVES
RCCRDLMEEKFNQVCIWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNH
VLSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAIQVD
ATVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGL
LKMLSLVLMHKPLRHPGMPKGLAHQLASPSLTNLPEASDVGSITLALRTLGSFEFEGHSL
TQFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKL
LVVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLS
SMNPAFVMPFLRKMLIQILTELEHSGVGRIKEQSARMLGHLVSNAPRLIRPYMEPILKAL
ILKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQV
ALWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKH
KVNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIF
RDQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGML
VSFVRSHIRPYMDEIVTLMREFWIMNSSIQSTIILLIEQIVVALGGEFKLYLPQLIPHML
RVFMHDSSTGRAVSIKLLNAIQLFGANLDDYLHLLLPPIVKLFDAPDAPLAARKAALETV
DRLTESLDFTDYASRIIHPIVRTLDLSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVL
VRHRITHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRTSQGETLASGPVETGPMKKLH
VSTINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFN
AAFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNG
IVLLGERAAKCRAYAKALHYKELEFQKGPSPAILESLISINNKLQQPEAAAGVLEYAMKH
FGELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCE
KWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSL
AQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERREIIRQIW
WERLQGCQRIVEDWQRILMVRSLVVNPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGV
DPSRQLDHPLPTVHPQVTYAYMKHMWKSARKIDAFQHMQHFVQTMQQQAQHAIAAEDQQH
KQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSASTEHDRNWYKAWHAWAVMNFE
AVLHYKHQNQARDEKKKLRHASGASITSANTEGSNSESEAESGENSPIPSPVQKKVTEDL
SKTLLLYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQID
TWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANK
ILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEP
LHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISK
QLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLT
LMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTN
SGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNN
TAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKI
LHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDS
VMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEMLDSVELGETAHKKTGT
TVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQAT
SHENLCQCYIGWCPFW
NT seq 7071 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggaggagtcaacccgcttctacgaccagctgaaccatcacatatttgaactg
gtttccagctcggatgccaacgagaggaaaggtggcatcctggccatcgccggcaagcac
agagcgagcaccgtcaggcacacgtacgaagaagcggagaaggggttcgatgagacgctg
gccaaggagaagggcatgaaccgggatgatcgaatccacggggccctgctgatcctcaac
gaactggtgcgaatcagcagtatggagggagaggtgtgcgggcagcccctggcaggagga
gccccgaggagggccctgaggtttctggagcgtttacgggagcgggcgctcctccccgcg
agttgggccctggccgagatccggggcccgcctcgccacatcacccccttcaccagcttc
caggccgtacagccccagcagtccaacgccttggtggggctgttggggtacagtgcccac
cagggcatcgtgggattcggggcctctcccatcccggtcaagtcgaccttggtggagagt
cgctgttgccgagatctgatggaagagaagttcaatcaggtatgcatctgggtgctcaag
tgcagaaacagtaagaactccctgatccaaatgaccatcctcaacctgctgcctcgcctg
gctgccttccggccttccgccttcacagacactcagtatctccaagacaccatgaaccac
gtactgagctgcgtcaagaaggagaaagagcgtacggcggcgttccaggccctggggctg
ctctccgtcgctgtgcgatccgagttcaaggtctacttgccccgagtgctggacatcatt
cgagcggcccttcctccgaaggactttgcccataagaggcagaaggccatacaagtggac
gccaccgtgttcacgtgcatcagcatgttggcccgagccatgggacccggcattcaacag
gacatcaaagagctgctggagcccatgttggccgtggggctgagccccgccctgacggcc
gtgctgtatgacctgagccgccagatcccgcagctgaagaaggacatccaggacgggctg
ctgaagatgctgtccctcgtcctgatgcacaaacccctccggcacccgggcatgcccaag
ggcctggcccaccagctggcctctcccagcctcaccaacctgcccgaggccagcgacgtg
ggcagcatcaccctggccctccgcacccttggcagctttgagtttgaaggccactctctg
acccaatttgtccgccactgcgcggatcacttcctgaacagtgaacacaaagagatccgc
atggaggcggctcgcacttgctcccgcctgctcaccccctccatccatctcatcagcggc
cacgcccacgtggtcagccagaccgcagtccaggtggtggccgacgtgctcagcaaactg
cttgtggtggggatcacggacccggaccccgacatccgttactgcgtcctggcctccctg
gacgagcgcttcgacgcccacctggcccaggcggagaacctgcaggccctgttcgtggcc
ctgaacgaccaggtgtttgagatccgagagctggccatctgcaccgtgggccggctgagc
agcatgaacccggccttcgtcatgcccttcctgcgcaagatgctcatccagatcctgacg
gagctggagcacagcggggtgggcagaatcaaggagcagagcgctcgcatgctgggccac
ttggtctccaacgccccccgtcttatccgcccgtacatggagcccattctgaaggcttta
atcttgaagctgaaagatccagaccctgatccgaacccaggggtgatcaataatgtcttg
gccacgataggggagctggcacaggtgagtggcctggaaatgaggaagtgggttgatgag
ctcttcatcatcatcatggatatgctccaggactcctctctgttggccaaaaggcaggtg
gctctgtggaccctgggacagctggtggccagtactggctatgtggtggagccctacagg
aaataccctaccctcttggaggtgctgctaaacttcctgaagacggagcagaaccaggga
acccgcagagaggccatccgggtgttggggctgctgggcgctttggatccctacaaacac
aaagtgaacatcggcatgattgaccagtcccgagatgcttctgccgtcagcctgtccgag
tccaagtctagccaggattcctccgactacagtaccagcgagatgttggtgaacatgggc
aacctgccgctggatgaattctaccctgccgtgtccatggtggccctgatgaggatcttc
cgagaccagtccctgtctcaccaccatacgatggtggtccaggccatcactttcatcttc
aaatccctggggctcaaatgcgtgcagtttttgccccaggtcatgcccacattcctcaac
gtgatccgggtctgcgacggggccatccgggagttcctgttccagcagctgggaatgtta
gtgtcctttgtgaggagccacatcagaccctacatggatgaaatcgtcaccctcatgaga
gagttctggatcatgaacagctcgatccagagcacaatcatcctcctcatcgagcagata
gtggttgccctcggaggggagttcaagctttacttgccccagctgatcccccacatgtta
cgggtcttcatgcatgacagcagcacaggacgcgccgtatccatcaagttgttgaacgcc
atccagctgttcggcgccaacttggacgactacttgcatttgctgctgcctccgatcgtc
aagctgttcgatgcccccgatgctcccctggcagctcgcaaggctgccctcgagactgta
gaccgtttgacggagtctctggatttcaccgattacgcctcccggattattcatcccata
gtgcggacgttggatctgagcccagagctgcggtccactgccatggacactctgtcttcg
ctcgtcttccagctggggaagaagtaccagatttttatcccaatggtcaacaaagtccta
gtgcggcatcgaatcacccaccaacgctatgacgtgctcatctgcaggattgttaagggc
tacaccctggctgacgaggaggaggaccctttgatttatcagcatcggatgctgaggact
agccaaggggagaccctggccagcgggccagtggagaccgggcccatgaagaaactgcac
gtcagtaccatcaacctgcagaaggcctggggagcggccaggagggtgtcgaaggatgac
tggttggagtggctgaggcggctgagcctggaactgctgaaggattcttcgtcgccttcg
ctgcgctcctgctgggccctggctcaggcctacaaccccatggccagggacctcttcaat
gccgcatttgtgtcctgctggtccgaactgaatgaagaccagcaagatgagctgattcga
agcatcgagctggccctgacctcccaagacatagcggaagtcacgcaaaccctcctgaac
ctggctgaattcatggagcacagcgataagggcccgctgccactgagagacgacaacggt
atcgtcctgctgggggagagagctgccaagtgccgagcgtatgccaaggcgttacactac
aaagagctggagttccagaagggccccagccccgcaatcctagaatcgctcatcagtatt
aataataaactacaacaaccggaggcagccgctggtgtgctggaatatgctatgaagcac
tttggagagctggagatccaggctacctggtatgagaagctgcatgagtgggaagatgcc
ttggtagcctacgataagaaaatggataccaacaaagatgaccccgagctgatgctgggc
cgaatgcgctgtcttgaggccttgggagaatggggtcagctccatcaacagtgctgtgaa
aaatggaccctggtgaatgacgagacccaagccaagatggcccggatggccgccgctgcc
gcctggggattaggtcagtgggacagtatggaggagtacacgtgcatgatcccccgggac
acccacgacggggcgttttacagggccgtgctggcactgcaccaggacctcttctcattg
gcccagcagtgcatagacaaagctagagacttattggatgccgagctgactgccatggcg
ggagagagctacagtcgggcgtatggggcaatggtttcctgccaaatgctatcggagctg
gaggaggttatccagtataaacttgtccccgagcgacgggaaatcatccgccagatctgg
tgggagaggctgcagggctgccaacggattgtcgaggactggcagagaatcctcatggtc
aggtctctggtcgtcaacccgcacgaagacatgagaacctggctcaagtatgccagcctt
tgtggcaagagcggcagactggctctcgctcataaaaccctggtcttgctcttgggagtt
gacccttctcgacagctggaccatccgttgccaacggttcacccgcaagtgacctacgcg
tacatgaagcacatgtggaagagcgctcgcaagatcgacgccttccagcacatgcagcac
tttgtccagacgatgcagcagcaggcccagcacgccatcgccgccgaggaccagcagcat
aagcaggagctccacaaactcatggcccgctgtttcctgaaactgggagaatggcagctg
aacctgcaaggcatcaacgaaagcacaatccctaaagtcctccagtattacagtgcctct
accgagcatgaccgcaactggtataaggcctggcacgcctgggcagtgatgaactttgag
gccgtgctgcactataagcatcaaaaccaggcccgagatgaaaagaagaaactgcgccat
gccagtggagccagcatcaccagcgcaaacaccgaggggagtaacagcgagagcgaggca
gaaagcggcgagaacagccccattccatctcccgtgcaaaagaaagtcactgaggatctg
tccaagacgctgttgttatacaccgttcctgccgtccagggtttcttccgctccatctct
ctgtcccggggcaacaatcttcaggacacactcagagtcctcactttgtggtttgactat
ggtcactggccagatgtcaacgaagccctggtagaaggtgtgaaggcgatccagatcgac
acctggttacaggttatcccccagctcattgcaagaatcgatactccccggcccctggtg
ggacgcctgattcatcagctcctcacggatattggccgatatcatccgcaggctctgatc
tacccactgaccgtggcatccaagtccaccaccactgcccgtcacaatgcagccaacaag
atcctgaaaaacatgtgtgaacacagcaacaccctggtccagcaggccatgatggtgagc
gaggagctgatccgggtggccatcctgtggcacgagatgtggcacgagggcttggaagag
gcttcccgcttatatttcggggagaggaacgtgaaagggatgtttgaggtcctggagcca
ctgcacgctatgatggagcggggaccccagaccctgaaggaaacgtcgttcaatcaggca
tatggtcgggatttgatggaggctcaagagtggtgccggaagtacatgaaatctgggaac
gtcaaggacctaacgcaggcctgggatctctattatcacgtgttcaggaggatctcaaaa
cagctacctcagcttacttccttggagttgcagtacgtgtcccccaaactcctgatgtgc
cgggaccttgaattagccgtgccgggaacctacgatcccaaccagcccatcatccgcatt
cagtccatagcaccttctttgcaggtcatcacatccaaacaaaggcccaggaagttgaca
ttaatgggcagcaacggccatgagtttgtcttccttctgaagggccacgaggacctccga
caggacgaacgggtgatgcagctctttggtctggttaacacccttctggccaacgacccg
acctctctgcggaaaaatctcagcatccagaggtacgccgtcattcccttatctaccaat
tcaggcctaattggctgggtcccccactgcgacactttgcacgcgctcatccgggattac
agggagaagaagaagatccttcttaatatcgagcatcgcatcatgttgcggatggctcca
gattacgaccacttgactctgatgcagaaggtggaggtatttgaacacgccgtcaataac
actgcaggagatgatctagccaaactgctgtggctaaaaagccccagctctgaggtgtgg
tttgaccgaagaaccaattacacccgttctttagctgtcatgtcgatggttgggtatatt
ttgggcttaggagacaggcacccatccaacctgatgctggacaggctaagcggaaagatc
ctgcacattgactttggagactgttttgaggttgcgatgaccagagagaagttcccagag
aagattccatttagactgacgagaatgttgaccaatgcaatggaggtgactggcctcgac
ggaaactacagaatcacctgtcacaccgtaatggaggttctccgtgaacacaaagacagt
gtgatggcggtgctggaagccttcgtttatgaccccttattgaactggaggctgatggat
acaaacacaaaaggcaataagcgatcacgaacaaggacagactcctactcagccggccag
tctgtagaaatgctggatagtgtggagcttggcgaaaccgcccacaagaaaactgggacc
acagtgcctgaatccatccattctttcattggtgacggtttggtgaaaccagaagctctg
aataagaaagctattcagattattaatagggttcgagataaactcaccggtcgggatttc
tctcacgacgagaccttggatgttcccacacaagtggagctgctgatcaagcaggcgact
tcccatgagaacctgtgtcagtgctacattggctggtgtccattctggtaa

DBGET integrated database retrieval system