KEGG   Ornithorhynchus anatinus (platypus): 100079867Help
Entry
100079867         CDS       T01045                                 

Gene name
USP40
Definition
ubiquitin specific peptidase 40
Orthology
K11869  
ubiquitin carboxyl-terminal hydrolase 40 [EC:3.1.2.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 1301 aa AA seqDB search
MIYGSTRRRDNFTMFGDLFDEDMYFGSNDNGMNGNKTKSKPKDVDPPAHREFTNLSGIRN
QGGTCYLNSLLQTLHFTPEFREALFSLGPEELGSLEDKDKPGAKVRIIPLQLQRLFAQLL
LLDQQAASTTDLTDSFGWDSSEEMRQHDVQELNRILFSALETSLVGTSGHDLINRLYHGT
VVNQIVCKECKNLSEKQEDFLDLTVAVKDVSGLEDALWNMYVEEEFFDCENLYHCGACDK
LVKAVKSTKLRKLPPFLTISLLRFNFDFVKCERYKETSNYTFPLQLNLKPFCEQNELDDS
EYTYDLFSVIIHKGGCYGGHYHVYIKDVDQLGNWQYQEEVAHENTLNSPVDQKEPKTCQE
IDNPLIVLEAIILQGCRLIQVDQLGQKILKKTGTSWNKKYRKQHGPIRKFLQSHSQIFLL
SSDCSKVGLKKTHPSQQPKLDFEAHNLNSSQSSKGLQFPEAQAVGPLELEDGPCGTHWFD
INDSSVQPIREKDIKKQFEGKESAYMLFYRKSQLQRPPEARSNPRYRVPCHLLNEMDTAN
IELQQKRADCDSAFNNIDLHLHLGSHYHFSNGALHPSSSRKESVLDLTIDRRKTLGDLRQ
SIFQILEFWEGDMVLSIAKSVPAGLHLFQTLYGDELSLRGIEIADGEDIFVWNGMEVSGE
KIPTGEDCVPVLLTVFRPSENNGGGKVEQVTESQHVFPANADISSVCTALAFPAGSIWMN
GAGSNVTELENWNVILKEDMKKTIRECGLKDGSSILLLRSNDCQERYLRNSFQIPWLQVK
NLCNLECEKDPIKIPVTWEMLMLDIRIKAITELQLPEDLAGNSCLRPINRKGKLLPPVPD
DFTIKDANLKLGNALGLCPGKAPTSTQLFLYFALGSDLQSGTEMEIIVEETISVKDCLKV
MLEKSGLPGDTWHLRKMDWCYEAGEALSEENATLKDLELCTGDTLVLTEGKLPPMGFLKV
LLWWYQPFTHSPQENVREQENGISCPTGTLKVTPAGEPYAAAVPRSYLPTVIMATQVPAC
RELPILKPSFPFVYQAYGPGVVQSEVSLRYIGDLEISQEASLEDLKIQALTLPSFLEVSI
PSPLFLRAWKMERKHPGKLLRNNQQPLKEYKLGERVEVCVELLQKKENLGSRDLLLRVQM
SIPHEREYSSPVDLAWDISKECTASSLTQQVANCYSLPVEKIEIAKYFPEKFEWMQINNW
TQQVSKKKRKKKLENLQTAPYHLKDGDIIGVKNLLLDDDRDFSTTRDDMGKKKLQQLTLG
KRKSRQAARLQNSDIFFDVREEPVRPHKPEAALSINVGVFR
NT seq 3906 nt NT seq  +upstreamnt  +downstreamnt
atgatctacggcagcaccagaaggcgagataatttcacaatgtttggtgacctgtttgac
gaggatatgtactttgggtcaaacgataatgggatgaatggtaataagacaaaatcgaag
ccgaaagatgtcgatcctccagctcatagggagttcaccaatttaagtggaatcagaaat
cagggtggcacgtgttacctcaattccctcctccagactcttcatttcacccctgaattc
agagaagcactattttctcttggtccagaagagcttggttctttagaagataaagataaa
ccaggagcaaaggttcgaatcatacctttacagctgcaacggttatttgctcaacttctg
ctcttagatcagcaggcagcatccacaacggatctcaccgacagcttcggatgggatagc
agcgaggaaatgaggcaacacgatgtgcaggaactgaatcggatcctcttcagtgcttta
gaaacctccctcgtgggcacttctggtcacgacctcattaatcgcttgtaccacggaaca
gttgtcaaccagattgtttgtaaagaatgtaagaacctcagtgagaaacaggaggatttc
ttagacttaactgtagctgtcaaagatgtatccggtttggaagacgctctgtggaacatg
tacgtagaagaggagttctttgactgtgaaaacctgtaccattgtggagcatgtgacaaa
ctggtcaaagcagtaaagtctaccaaattgcgtaagctgcctccttttcttactatttca
ctgctaagatttaattttgattttgtcaagtgtgagcgatacaaggaaacaagcaactat
acattccctctgcagctcaatctcaagcctttttgtgagcagaatgagttggatgactca
gagtatacctatgatctcttctccgttatcatacacaaaggtggctgctatggtggacat
taccatgtatatattaaagatgttgatcagttgggaaactggcaatatcaagaggaagtt
gcacatgaaaatactttgaacagcccagttgatcagaaagaacctaaaacttgccaagaa
atagacaatccactgatagtcctggaagcaattattttacaggggtgtaggctcattcag
gtggaccagctaggtcagaagattttgaaaaaaacaggaacttcgtggaacaagaagtac
cgtaaacagcatggacccataagaaagtttttacagagccattctcagatatttctgctc
agttctgattgcagcaaggttggtctgaagaaaacgcatccttcacagcagcccaagctt
gacttcgaagcacacaacctaaacagttctcagagtagcaaaggtcttcagtttcctgaa
gcacaggctgtaggacctctggagttagaagatggcccatgtggtacccattggtttgat
ataaatgattccagtgtccaacccatcagggaaaaggatatcaagaagcaatttgaggga
aaagaaagtgcttatatgttgttctatcgaaaatcccagttgcaaagaccacctgaagct
cgatcaaatccaagatacagagtcccatgccatctgcttaatgaaatggacacagccaac
attgaactgcagcaaaagagggcagactgtgactctgcgttcaataacattgacttacat
ctccatctgggctcacattatcatttttctaatggagcattacacccatcatcgtctcga
aaagagagcgtgctggatttaactatcgatagaagaaaaactctaggggatctccgacaa
tcaatatttcagattttagaattttgggaaggagacatggttcttagtattgcaaagtct
gtgccagcaggacttcaccttttccaaacactttatggggatgagctaagtttgcgtgga
attgaaattgctgatggggaagacatctttgtatggaatgggatggaggttagtggggag
aaaataccgactggcgaggactgtgtacctgtgcttctgactgtgtttcgaccctcagaa
aacaatggaggaggaaaggttgagcaggtgacagaatcccagcatgtctttccagccaat
gcagacataagctccgtatgcacagccctggcattcccagcagggagcatctggatgaac
ggtgccggatccaatgtcaccgaattagagaactggaatgttattctcaaggaggacatg
aaaaaaactatcagggaatgtggcctcaaagatggaagttcgattctacttttaagatct
aacgactgtcaggaaaggtacctcagaaattcatttcaaatcccctggttacaagttaaa
aatttatgcaacttggagtgtgaaaaagatccaattaaaattcctgtgacttgggaaatg
ctgatgttggatattcgaattaaagctataacagaattgcagctgccagaagacttagct
ggtaatagctgtttgaggccaattaacagaaaaggaaagcttcttcctcccgtgccagat
gatttcacaatcaaagacgcaaacctgaagctgggaaatgcgttaggattgtgtcctgga
aaggccccgacttccactcagctcttcttgtattttgctcttgggagtgatctacagtct
ggcacagaaatggagatcatagtggaagaaacgatatctgtaaaagattgcttaaaagtt
atgctggagaaatctggtttgccaggtgacacttggcatttgagaaaaatggattggtgt
tatgaagcgggagaagcattaagtgaggaaaatgccactctgaaagatcttgaactatgc
acgggagataccttggtcctaactgaagggaagcttccacccatgggtttccttaaagtg
cttctctggtggtaccagcctttcactcactctccacaagaaaatgtgcgagaacaagaa
aatggcatttcatgcccaacagggactctgaaagttaccccagctggagaaccgtatgcc
gcagcagtgccaagaagttatctgcccactgttataatggcaacacaggttcctgcatgt
agggagctgccaatccttaaaccttccttcccctttgtgtaccaagcctatggtccgggg
gttgtccaaagtgaagtgtcactccgctacattggggatcttgaaatctcccaagaggcc
tccttagaagatctgaagattcaggctctgaccttgccatctttcctggaggtcagcatc
ccatcccctctcttccttcgagcctggaaaatggaaaggaagcatccaggcaagctttta
cgaaacaaccaacaaccactcaaggaatataaactaggtgagagagtggaagtttgtgta
gagcttcttcaaaagaaagagaatctgggctccagggacttactactgagggtccagatg
agtatacctcatgagagagagtactcttcgcctgtggatttggcgtgggatatctccaaa
gaatgcacagcatcctcactaactcaacaagttgctaattgctactctcttcctgtggag
aaaattgaaattgccaaatactttcccgagaagtttgagtggatgcagataaataactgg
actcaacaggtttccaagaagaaaaggaagaagaaactggaaaatttacagacagctcct
tatcacttgaaggatggagatattattggtgttaagaacctcctccttgatgacgacaga
gacttcagtacaacacgagatgatatgggcaagaagaaactacagcagctcacactggga
aaaaggaaaagccggcaagccgctcgcttacagaatagcgatatattcttcgacgtacgg
gaggagcctgttcgaccccacaaacccgaagccgctctttctatcaacgtcggggtcttc
agatag

DBGET integrated database retrieval system