KEGG   Ornithorhynchus anatinus (platypus): 100079867Help
Entry
100079867         CDS       T01045                                 

Gene name
USP40
Definition
ubiquitin specific peptidase 40
Orthology
K11869  
ubiquitin carboxyl-terminal hydrolase 40 [EC:3.1.2.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100079867 (USP40)
Peptidases [BR:oaa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100079867 (USP40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 1256 aa AA seqDB search
MFGDLFDEDMYFGSNDNGMNGNKTKSKPKDVDPPAHREFTNLSGIRNQGGTCYLNSLLQT
LHFTPEFREALFSLGPEELGSLEDKDKPGAKVRIIPLQLQRLFAQLLLLDQQAASTTDLT
DSFGWDSSEEMRQHDVQELNRILFSALETSLVGTSGHDLINRLYHGTVVNQIVCKECKNL
SEKQEDFLDLTVAVKDVSGLEDALWNMYVEEEFFDCENLYHCGACDKLVKAVKSTKLRKL
PPFLTISLLRFNFDFVKCERYKETSNYTFPLQLNLKPFCEQNELDDSEYTYDLFSVIIHK
GGCYGGHYHVYIKDVDQLGNWQYQEEVAHENTLNSPVDQKEPKTCQEIDNPLIVLEAIIL
QEGCRLIQVDQLGQKILKKTGTSWNKKYRKQHGPIRKFLQSHSQIFLLSSDCSKVGLKKT
HPSQQPKLDFEAHNLNSSQSSKGLQFPEAQAVGPLELEDGPCGTHWFDINDSSVQPIREK
DIKKQFEGKESAYMLFYRKSQLQRPPEARSNPRYRVPCHLLNEMDTANIELQQKRADCDS
AFNNIDLHLHLGSHYHFSNGALHPSSSRKESVLDLTIDRRKTLGDLRQSIFQILEFWEGD
MVLSIAKSVPAGLHLFQTLYGDELSLRGIEIADGEDIFVWNGMEVSGEKIPTGEDCVPVL
LTVFRPSENNGGGKVEQVTESQHVFPANADISSVCTALAFPAGSIWMNGAGSNVTELENW
NVILKEDMKKTIRECGLKDGSSILLLRSNDCQESLVLEMDNLTAFICGSPWLQVKNLCNL
ECEKDPIKIPVTWEMLMLDIRIKAITELQLPEDLAGNSCLRPINRKGKLLPPVPDDFTIK
DANLKLGNALGLCPGKAPTSTQLFLYFALGSDLQSGTEMEIIVEETISVKDCLKVMLEKS
GLPGDTWHLRKMDWCYEAGEALSEENATLKDLELCTGDTLVLTEGKLPPMGFLKVLLWWY
QPFTHSPQENVREQENGISCPTGTLKVTPAGDGPGVVQSEVSLRYIGDLEISQEASLEDL
KIQALTLPSFLEVSIPSPLFLRAWKMERKHPGKLLRNNQQPLKEYKLGERVEVCVELLQK
KENLGSRDLLLRVQMSIPHEREYSSPVDLAWDISKECTASSLTQQVANCYSLPVEKIEIA
KYFPEKFEWMQINNWTQQVSKKKRKKKLENLQTAPYHLKDGDIIGVKNLLLDDDRDFSTT
RDDMGKKKLQQLTLGKRKSRQAARLQNSDIFFDVREEPVRPHKPEAALSINVGVFR
NT seq 3771 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtgacctgtttgacgaggatatgtactttgggtcaaacgataatgggatgaat
ggtaataagacaaaatcgaagccgaaagatgtcgatcctccagctcatagggagttcacc
aatttaagtggaatcagaaatcagggtggcacgtgttacctcaattccctcctccagact
cttcatttcacccctgaattcagagaagcactattttctcttggtccagaagagcttggt
tctttagaagataaagataaaccaggagcaaaggttcgaatcatacctttacagctgcaa
cggttatttgctcaacttctgctcttagatcagcaggcagcatccacaacggatctcacc
gacagcttcggatgggatagcagcgaggaaatgaggcaacacgatgtgcaggaactgaat
cggatcctcttcagtgctttagaaacctccctcgtgggcacttctggtcacgacctcatt
aatcgcttgtaccacggaacagttgtcaaccagattgtttgtaaagaatgtaagaacctc
agtgagaaacaggaggatttcttagacttaactgtagctgtcaaagatgtatccggtttg
gaagacgctctgtggaacatgtacgtagaagaggagttctttgactgtgaaaacctgtac
cattgtggagcatgtgacaaactggtcaaagcagtaaagtctaccaaattgcgtaagctg
cctccttttcttactatttcactgctaagatttaattttgattttgtcaagtgtgagcga
tacaaggaaacaagcaactatacattccctctgcagctcaatctcaagcctttttgtgag
cagaatgagttggatgactcagagtatacctatgatctcttctccgttatcatacacaaa
ggtggctgctatggtggacattaccatgtatatattaaagatgttgatcagttgggaaac
tggcaatatcaagaggaagttgcacatgaaaatactttgaacagcccagttgatcagaaa
gaacctaaaacttgccaagaaatagacaatccactgatagtcctggaagcaattatttta
caggaggggtgtaggctcattcaggtggaccagctaggtcagaagattttgaaaaaaaca
ggaacttcgtggaacaagaagtaccgtaaacagcatggacccataagaaagtttttacag
agccattctcagatatttctgctcagttctgattgcagcaaggttggtctgaagaaaacg
catccttcacagcagcccaagcttgacttcgaagcacacaacctaaacagttctcagagt
agcaaaggtcttcagtttcctgaagcacaggctgtaggacctctggagttagaagatggc
ccatgtggtacccattggtttgatataaatgattccagtgtccaacccatcagggaaaag
gatatcaagaagcaatttgagggaaaagaaagtgcttatatgttgttctatcgaaaatcc
cagttgcaaagaccacctgaagctcgatcaaatccaagatacagagtcccatgccatctg
cttaatgaaatggacacagccaacattgaactgcagcaaaagagggcagactgtgactct
gcgttcaataacattgacttacatctccatctgggctcacattatcatttttctaatgga
gcattacacccatcatcgtctcgaaaagagagcgtgctggatttaactatcgatagaaga
aaaactctaggggatctccgacaatcaatatttcagattttagaattttgggaaggagac
atggttcttagtattgcaaagtctgtgccagcaggacttcaccttttccaaacactttat
ggggatgagctaagtttgcgtggaattgaaattgctgatggggaagacatctttgtatgg
aatgggatggaggttagtggggagaaaataccgactggcgaggactgtgtacctgtgctt
ctgactgtgtttcgaccctcagaaaacaatggaggaggaaaggttgagcaggtgacagaa
tcccagcatgtctttccagccaatgcagacataagctccgtatgcacagccctggcattc
ccagcagggagcatctggatgaacggtgccggatccaatgtcaccgaattagagaactgg
aatgttattctcaaggaggacatgaaaaaaactatcagggaatgtggcctcaaagatgga
agttcgattctacttttaagatctaacgactgtcaggaaagcttggtgttggaaatggat
aatctgactgcttttatatgtggaagcccctggttacaagttaaaaatttatgcaacttg
gagtgtgaaaaagatccaattaaaattcctgtgacttgggaaatgctgatgttggatatt
cgaattaaagctataacagaattgcagctgccagaagacttagctggtaatagctgtttg
aggccaattaacagaaaaggaaagcttcttcctcccgtgccagatgatttcacaatcaaa
gacgcaaacctgaagctgggaaatgcgttaggattgtgtcctggaaaggccccgacttcc
actcagctcttcttgtattttgctcttgggagtgatctacagtctggcacagaaatggag
atcatagtggaagaaacgatatctgtaaaagattgcttaaaagttatgctggagaaatct
ggtttgccaggtgacacttggcatttgagaaaaatggattggtgttatgaagcgggagaa
gcattaagtgaggaaaatgccactctgaaagatcttgaactatgcacgggagataccttg
gtcctaactgaagggaagcttccacccatgggtttccttaaagtgcttctctggtggtac
cagcctttcactcactctccacaagaaaatgtgcgagaacaagaaaatggcatttcatgc
ccaacagggactctgaaagttaccccagctggagatggtccgggggttgtccaaagtgaa
gtgtcactccgctacattggggatcttgaaatctcccaagaggcctccttagaagatctg
aagattcaggctctgaccttgccatctttcctggaggtcagcatcccatcccctctcttc
cttcgagcctggaaaatggaaaggaagcatccaggcaagcttttacgaaacaaccaacaa
ccactcaaggaatataaactaggtgagagagtggaagtttgtgtagagcttcttcaaaag
aaagagaatctgggctccagggacttactactgagggtccagatgagtatacctcatgag
agagagtactcttcgcctgtggatttggcgtgggatatctccaaagaatgcacagcatcc
tcactaactcaacaagttgctaattgctactctcttcctgtggagaaaattgaaattgcc
aaatactttcccgagaagtttgagtggatgcagataaataactggactcaacaggtttcc
aagaagaaaaggaagaagaaactggaaaatttacagacagctccttatcacttgaaggat
ggagatattattggtgttaagaacctcctccttgatgacgacagagacttcagtacaaca
cgagatgatatgggcaagaagaaactacagcagctcacactgggaaaaaggaaaagccgg
caagccgctcgcttacagaatagcgatatattcttcgacgtacgggaggagcctgttcga
ccccacaaacccgaagccgctctttctatcaacgtcggggtcttcagatag

  All links  
No link information was found.   
DBGET integrated database retrieval system