KEGG   Ornithorhynchus anatinus (platypus): 100079889Help
Entry
100079889         CDS       T01045                                 

Gene name
XIAP
Definition
X-linked inhibitor of apoptosis
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100079889 (XIAP)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    100079889 (XIAP)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100079889 (XIAP)
  Cell communication
   04510 Focal adhesion
    100079889 (XIAP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100079889 (XIAP)
   05222 Small cell lung cancer
    100079889 (XIAP)
  Infectious diseases
   05166 HTLV-I infection
    100079889 (XIAP)
   05145 Toxoplasmosis
    100079889 (XIAP)
Mitochondrial biogenesis [BR:oaa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100079889 (XIAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 439 aa AA seqDB search
MAKPCWKEEMTCNSPEELRTSNPSEVNKDEEFAEEHNRLRTFANFPSTSPVSSSTLARAG
FLYTGEEDVVRCFSCHVAVDRWQYGDSAIGRHRKISPNCRFVNGCHFKNCALPLANASLQ
NGELGQVEECPGNPSHHALERSSETHSDYLLRTRQVVDLSDTVFPKNPAMCSEEARLETF
QNWPEYTLLSPGQLARAGLYYSGIDDQVECFCCGGKLKNWEPCDRPWSEHKRHFPKCLFV
LGRDVGNIEIESDSIASQRSYSNSTHFPRNPAMAEFEARIHTFETWTYSIDKELLARAGF
YTLGEQDKVICFHCGGGLTDWKPNEDPWEQHAKWFPGCKYLVEQKGQEFINNVHLTQSLE
DSVLEADETPPSLTKEISPEEELRRLQEEKLCKICMDKNIAVVFLPCGHLVACKECGEAM
GKCPVCCTLINYRQKIFMS
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagccctgctggaaagaggaaatgacctgtaacagtccggaagaactcagaact
tcaaatccttcagaggtaaataaagatgaagaatttgcagaagagcataacagattaaga
acttttgctaattttccaagtactagccctgtttcttcatcaactctggcccgagctggt
ttcctttatacgggcgaagaagatgtcgtgcgatgcttcagttgccatgtagctgtagat
cgttggcagtatggtgactcagcaattggcaggcaccgaaaaatttcccccaactgcaga
tttgtcaatggatgtcattttaagaactgtgctctgcctttagcaaatgcaagtctccaa
aacggtgaactcggtcaagttgaagaatgcccaggaaatccaagtcaccacgctttggaa
agatcatccgaaactcattcggactaccttttgagaacgaggcaggttgtcgacctatcg
gatacggtattcccgaagaaccctgccatgtgcagcgaagaagccagactagaaacattt
cagaattggcccgaatataccctgttatccccagggcaattagctagagctggactgtac
tactcaggtattgatgatcaagtagaatgcttttgttgtggtggaaagttgaaaaactgg
gagccgtgcgatcgtccgtggtcagagcacaaacggcatttcccaaagtgcctttttgtc
ttgggccgggatgttggaaacattgaaattgaatctgatagcatcgcttcccagaggagt
tattcaaattcaactcatttcccgaggaatccggccatggcagagtttgaagcccggatc
cacacttttgagacatggacatactccattgacaaggagctgcttgcaagagcaggattt
tatactctaggtgagcaagataaggttatttgctttcattgtggaggagggttaactgat
tggaagccaaatgaagacccttgggagcaacatgctaaatggtttccaggatgcaagtac
cttgttgagcagaagggacaagagtttattaacaatgttcacttgactcagtctcttgaa
gattctgtgttagaagctgatgagacaccgccatcattgactaaagagattagccctgaa
gaggagctaagacgtctgcaagaggaaaagctttgcaaaatctgcatggataaaaatatt
gcagtagtttttcttccctgtggacatctggttgcttgcaaagaatgtggtgaagcgatg
ggcaagtgtccggtgtgctgcactctcattaactacaggcagaaaatttttatgtcttag

DBGET integrated database retrieval system