KEGG   Ornithorhynchus anatinus (platypus): 100080036Help
Entry
100080036         CDS       T01045                                 

Definition
histone deacetylase 4-like
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Alcoholism
Epstein-Barr virus infection
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:oaa05203]
Human Diseases; Substance dependence; Alcoholism [PATH:oaa05034]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:oaa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 1122 aa AA seqDB search
MDICVIFESVYFVAFAELLLVNYHSEIFSLGCQPLMKPNAFFCSPDGLSGRDQPVELLNP
TRVNHMPSTVDVTTALPLQVAPSSVPMDLRLDHQFSMPGSEPTLREQQLQQELLALKQKQ
QIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLEQHRQEQE
LEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYW
YGKTQHSSLDQSSPPQSGVSATYNHPVLGMYDSKDDFPLRKTASEPNLKLRSRLKQKVAE
RRSSPLLRRKDGPVVTALKKRPLDVTDSACNSAPGSGPSSPNNSSNNISNENGIAGSVTS
IQAETSLAHRLVNREGSVTQLPLYTSPSLPNITLGLPATGPSSGGSGQQEAERLAIPTLQ
QRISLFPGTHLTPYLSTTTLERDGGTAHNPLLQHMVLLEQPAAQTPLVTGLGALPLHAQT
LVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQQLVIQQQHQQFLEKHKQQFQQQQL
HINKMIPKANEPSRQHESHPEETEEELREHQALLEEPYSDRIPNQKEAQALASMVQVKQE
PIESDEEDTELPQEVEQGQRQAEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFG
SHRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRI
QSVWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSL
TSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELVFKVATGELKNGFAVVRPPGH
HAEESTPMGFCYFNSVAIAAKLLQQRLNVSKILIVDWDVHHGNGTQQAFYNDPNVLYISL
HRYDDGNFFPGSGSPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEYLTAFRTVVMPIANEF
APDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGRIVLALEGGHDLTAIC
DASEACVSALLGNELDPLPEKVLQQRSNENAVHSMEKVIEIHSKYWRSLQRFSSTVGYSL
IEAQKCENEEAETVTAMASLSVGVKQAEKRPDEEPMEEEPPL
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atggatatctgtgtcatttttgagtcggtttattttgtagcttttgcagagttgcttcta
gtaaattatcattctgaaatattttcactgggctgccagccactcatgaagccaaatgct
tttttctgttctccagatggactttctggccgagaccagccagtagagctgctaaatcca
acccgagtgaaccacatgcctagtactgtggacgtgaccacagccctgcccttgcaagtc
gcaccctcttccgtgcccatggacctccgtctggaccaccagttttctatgccggggagc
gaacccacgctccgagagcagcagctccagcaagagcttctcgccctgaagcagaagcag
cagatccagaggcagatcctcatcgcagagttccagaggcagcacgagcagctctctcgc
cagcacgaggctcagcttcatgaacacataaaacagcaacaggaaatgttagccatgaaa
catcagcaggaacttctggaacatcagaggaaactggaacagcatcgccaggagcaggaa
ctagagaagcagcatagagaacagaagttacagcagctcaaaaacaaggagaaagggaaa
gaaagcgctgtagcaagcacagaagtcaaaatgaagttgcaagagtttgtcctcaataaa
aagaaagccctggcacacaggaatctgaatcattgcatttccagcgatcctcgctactgg
tatgggaaaactcagcacagttccctggaccagagctctcccccacaaagtggagtgtcc
gccacctacaatcacccagtgctgggaatgtatgactccaaagatgactttcctcttaga
aaaacagcctctgaacccaatctgaaattacgatccaggctaaagcagaaagttgctgaa
agacggagcagccccctgttacgcaggaaagatggcccagtggttactgctcttaaaaag
cgtccattggatgtcacagattctgcctgcaatagtgctcctgggtctggtcccagttct
cccaacaacagttccaataatatcagcaatgagaatggaattgctggatctgtcacaagt
attcaagcagagaccagtttggctcacagacttgtgaatcgagaaggctcagtaacacaa
cttcccctttacacatcgccctccttgcccaacataacattaggacttcctgctaccggc
ccatcgagtggcggatcaggacagcaggaagccgagagacttgctattccaaccctccag
cagcggatctccctctttcccggcacccacctcactccttacttgagcactacgacgttg
gagagggatgggggaacagcacacaaccctcttctgcaacatatggtcttactggaacaa
ccagctgcacaaacccccttagtcacaggcctgggagcgttgcccctccacgcacagact
ctggttggcgccgatcgggtgtccccgtcaatacacaagctgcggcagcatcgccccttg
gggcgcacccagtctgctcctctgccccagaatgcccaggctcttcagcagttagtgatc
cagcaacagcatcagcagttcctggagaaacacaaacagcaattccagcaacagcaactg
cacattaacaagatgatacccaaagcaaatgaaccatcccgccagcatgaaagtcacccc
gaagagactgaagaggagctccgggaacaccaagcacttttggaggagccatactctgac
cggattcccaaccagaaggaggcccaggcgttagccagcatggtgcaggtgaagcaagag
cccattgagagtgatgaggaggacacggaactgccccaagaggtggagcaagggcagaga
caagctgaacaggaactactcttcagacagcaagcgcttttactggaacaacaacggatc
caccagttgagaaactaccaagcatcgatggaagcagcaggaatccccgtttcctttggc
agtcaccggcctctgtcccgtgcacaatcttctcctgcatctgctacttttcccatgtct
gtacaggagccacccactaaaccgaggttcacaacaggtcttgtatatgacaccttgatg
ctgaaacaccagtgtacctgtggaaacaccaatagccatcctgaacatgctggtcgaatc
cagagcgtttggtctcggcttcaggagactggcctccgcggcaagtgtgagtgtattcgt
ggaagaaaggcaactctggaagagttacagacggttcactctgaagcccataccctgctt
tatggcacaaaccccttgaacagacagaaactggacagtaagaaacttctaggttcttta
acatcagtttttgtaaggctcccttgtggtggtgttggagtggacagtgacaccatatgg
aacgaagtgcattcatctggggccgcacgcttggcagttggctgcgtcgtggagcttgtc
ttcaaagtggccactggagagctgaagaatggctttgctgtagttaggcctccaggtcat
catgcggaagaaagtacaccaatgggcttctgctattttaattctgtggcgattgcagct
aaacttctccaacagagactgaatgttagcaagatccttatagtcgactgggatgtgcac
catgggaatggcactcagcaagctttttacaatgaccctaatgttctttatatttcacta
catcgctatgatgatgggaacttcttcccagggagcgggtcacctgacgaggttggcaca
ggaccaggcgttggcttcaatgtcaatatggcttttactggtggccttgatccaccaatg
ggagatgccgagtacttaacagctttcagaacggtagtaatgccaatcgctaacgagttt
gcccctgatgtggtgctggtatcttctggctttgatgcagtagaaggccatcctacgcct
cttggaggctataatctgtcagcaaaatgttttgggtacctgacgaagcagctgatggga
ttggctggcggccggattgttctggcccttgaaggaggtcatgacctgacagctatttgc
gatgcgtctgaagcatgtgtttctgctttgctgggaaacgagcttgatcctctcccagaa
aaggttttacaacaaagatcgaatgagaacgcggtccactcaatggaaaaagtcattgaa
attcacagcaagtactggcgttcactacagcgcttttcctcaacagtgggatattcccta
attgaggctcagaaatgtgagaatgaagaggctgagactgtcaccgctatggcctcgctg
tcagtcggtgttaaacaggctgaaaagagacccgatgaagaacctatggaggaggagcca
cccctgtag

DBGET integrated database retrieval system