KEGG   Ornithorhynchus anatinus (platypus): 100080036Help
Entry
100080036         CDS       T01045                                 

Gene name
HDAC4
Definition
histone deacetylase 4
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Alcoholism
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100080036 (HDAC4)
  Substance dependence
   05034 Alcoholism
    100080036 (HDAC4)
  Infectious diseases
   05169 Epstein-Barr virus infection
    100080036 (HDAC4)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100080036 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 1117 aa AA seqDB search
MSSQSHPDDDGIFSDGLSGRDQPVELLNPTRVNHMPSTVDVTTALPLQVAPSSVPMDLRL
DHQFSMPGSEPTLREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIK
QQQEMLAMKHQQELLEHQRKLEQHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKM
KLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSATYNHPVLGMY
DSKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACN
SAPGSGPSSPNNSSNNISNENGIAGSVTSIQAETSLAHRLVNREGSVTQLPLYTSPSLPN
ITLGLPATGPSSGGSGQQEAERLAIPTLQQRISLFPGTHLTPYLSTTTLERDGGTAHNPL
LQHMVLLEQPAAQTPLVTGLGALPLHAQTLVGADRVSPSIHKLRQHRPLGRTQSAPLPQN
AQALQQLVIQQQHQQFLEKHKQQFQQQQLHINKMIPKANEPSRQHESHPEETEEELREHQ
ALLEEPYSDRIPNQKEAQALASMVQVKQEPIESDEEDTELPQEVEQGQRQAEQELLFRQQ
ALLLEQQRIHQLRNYQASMEAAGIPVSFGSHRPLSRAQSSPASATFPMSVQEPPTKPRFT
TGLVYDTLMLKHQCTCGNTNSHPEHAGRIQSVWSRLQETGLRGKCECIRGRKATLEELQT
VHSEAHTLLYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARL
AVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSK
ILIVDWDVHHGNGTQQAFYNDPNVLYISLHRYDDGNFFPGSGSPDEVGTGPGVGFNVNMA
FTGGLDPPMGDAEYLTAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCF
GYLTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRSNENA
VHSMEKVIEIHSKYWRSLQRFSSTVGYSLIEAQKCENEEAETVTAMASLSVGVKQAEKSI
CRYKGGTFSVKQNMEGEWKNKVCVLLKLFLRNLCFLL
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatgatgatgggattttttcagatggactttctggccga
gaccagccagtagagctgctaaatccaacccgagtgaaccacatgcctagtactgtggac
gtgaccacagccctgcccttgcaagtcgcaccctcttccgtgcccatggacctccgtctg
gaccaccagttttctatgccggggagcgaacccacgctccgagagcagcagctccagcaa
gagcttctcgccctgaagcagaagcagcagatccagaggcagatcctcatcgcagagttc
cagaggcagcacgagcagctctctcgccagcacgaggctcagcttcatgaacacataaaa
cagcaacaggaaatgttagccatgaaacatcagcaggaacttctggaacatcagaggaaa
ctggaacagcatcgccaggagcaggaactagagaagcagcatagagaacagaagttacag
cagctcaaaaacaaggagaaagggaaagaaagcgctgtagcaagcacagaagtcaaaatg
aagttgcaagagtttgtcctcaataaaaagaaagccctggcacacaggaatctgaatcat
tgcatttccagcgatcctcgctactggtatgggaaaactcagcacagttccctggaccag
agctctcccccacaaagtggagtgtccgccacctacaatcacccagtgctgggaatgtat
gactccaaagatgactttcctcttagaaaaacagcctctgaacccaatctgaaattacga
tccaggctaaagcagaaagttgctgaaagacggagcagccccctgttacgcaggaaagat
ggcccagtggttactgctcttaaaaagcgtccattggatgtcacagattctgcctgcaat
agtgctcctgggtctggtcccagttctcccaacaacagttccaataatatcagcaatgag
aatggaattgctggatctgtcacaagtattcaagcagagaccagtttggctcacagactt
gtgaatcgagaaggctcagtaacacaacttcccctttacacatcgccctccttgcccaac
ataacattaggacttcctgctaccggcccatcgagtggcggatcaggacagcaggaagcc
gagagacttgctattccaaccctccagcagcggatctccctctttcccggcacccacctc
actccttacttgagcactacgacgttggagagggatgggggaacagcacacaaccctctt
ctgcaacatatggtcttactggaacaaccagctgcacaaacccccttagtcacaggcctg
ggagcgttgcccctccacgcacagactctggttggcgccgatcgggtgtccccgtcaata
cacaagctgcggcagcatcgccccttggggcgcacccagtctgctcctctgccccagaat
gcccaggctcttcagcagttagtgatccagcaacagcatcagcagttcctggagaaacac
aaacagcaattccagcaacagcaactgcacattaacaagatgatacccaaagcaaatgaa
ccatcccgccagcatgaaagtcaccccgaagagactgaagaggagctccgggaacaccaa
gcacttttggaggagccatactctgaccggattcccaaccagaaggaggcccaggcgtta
gccagcatggtgcaggtgaagcaagagcccattgagagtgatgaggaggacacggaactg
ccccaagaggtggagcaagggcagagacaagctgaacaggaactactcttcagacagcaa
gcgcttttactggaacaacaacggatccaccagttgagaaactaccaagcatcgatggaa
gcagcaggaatccccgtttcctttggcagtcaccggcctctgtcccgtgcacaatcttct
cctgcatctgctacttttcccatgtctgtacaggagccacccactaaaccgaggttcaca
acaggtcttgtatatgacaccttgatgctgaaacaccagtgtacctgtggaaacaccaat
agccatcctgaacatgctggtcgaatccagagcgtttggtctcggcttcaggagactggc
ctccgcggcaagtgtgagtgtattcgtggaagaaaggcaactctggaagagttacagacg
gttcactctgaagcccataccctgctttatggcacaaaccccttgaacagacagaaactg
gacagtaagaaacttctaggttctttaacatcagtttttgtaaggctcccttgtggtggt
gttggagtggacagtgacaccatatggaacgaagtgcattcatctggggccgcacgcttg
gcagttggctgcgtcgtggagcttgtcttcaaagtggccactggagagctgaagaatggc
tttgctgtagttaggcctccaggtcatcatgcggaagaaagtacaccaatgggcttctgc
tattttaattctgtggcgattgcagctaaacttctccaacagagactgaatgttagcaag
atccttatagtcgactgggatgtgcaccatgggaatggcactcagcaagctttttacaat
gaccctaatgttctttatatttcactacatcgctatgatgatgggaacttcttcccaggg
agcgggtcacctgacgaggttggcacaggaccaggcgttggcttcaatgtcaatatggct
tttactggtggccttgatccaccaatgggagatgccgagtacttaacagctttcagaacg
gtagtaatgccaatcgctaacgagtttgcccctgatgtggtgctggtatcttctggcttt
gatgcagtagaaggccatcctacgcctcttggaggctataatctgtcagcaaaatgtttt
gggtacctgacgaagcagctgatgggattggctggcggccggattgttctggcccttgaa
ggaggtcatgacctgacagctatttgcgatgcgtctgaagcatgtgtttctgctttgctg
ggaaacgagcttgatcctctcccagaaaaggttttacaacaaagatcgaatgagaacgcg
gtccactcaatggaaaaagtcattgaaattcacagcaagtactggcgttcactacagcgc
ttttcctcaacagtgggatattccctaattgaggctcagaaatgtgagaatgaagaggct
gagactgtcaccgctatggcctcgctgtcagtcggtgttaaacaggctgaaaagagcatc
tgcagatacaaaggtggaacattttctgtcaaacaaaacatggaaggagagtggaaaaac
aaagtttgcgtcttactgaaattattcttaagaaatttgtgctttttattgtaa

DBGET integrated database retrieval system