KEGG   Ornithorhynchus anatinus (platypus): 100080058Help
Entry
100080058         CDS       T01045                                 

Gene name
CCNH
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100080058 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    100080058 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100080058 (CCNH)
Transcription machinery [BR:oaa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100080058 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 566 aa AA seqDB search
MKVQNLNSSFLSVEKEEASSKLDSKQGSQKRSSKKYRKMYCTENTTKGQRITFKTLGYQS
IRKQAEQGVFSMVRKEQSTCCLYTPRKALYGAALRETPFEVTSQSPPEPEQQAGLNRKKA
SFDSSPVFIKEAHKEISSVALLFYQTSSKPEQLQYTIPEMQTNLLVSKIYRKSSEPITEI
GILTVLQAKQLHRRPALLFATGDELKGNDPELKEVRLRYGIKKTCKGDSKIGSHRGHSYS
RRLSAVPTIKDQLLEALPSPRYPKRGQKIHLGVGVGLLTDSGVLPNDPIFLDPQEELTIC
KYYEKRLLDFCSVFKPAMPKSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDE
FNVSSIQFVGNVRDSPFGQEKALEQILEYELLLIQQLNFHLIVHNPFRPFEGFLIDLKTR
YPLLENPEILRKAADDFLNRVALTDAYLLFTPSQIALTAILSSASRAGITMESYLSESLM
LKENRTCMSQLLDVVKCMKNLVKKYESPKPEEVAVLKQKLERCHSSELATNVNVKKRKGY
EDDEYVSKKPKLEEEEWTDDDLVDSL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtacagaatctaaactctagtttcctttctgtagaaaaggaagaagccagttca
aagctagactcaaaacaaggaagtcagaagagatcatctaaaaagtacagaaagatgtat
tgtactgaaaacactaccaaaggccaacggatcacctttaagactctggggtaccaaagc
attaggaagcaggcagaacaaggtgtcttcagcatggtaaggaaagagcagtctacctgc
tgcctttacacccccagaaaggccttatatggagctgcactgcgggagaccccctttgag
gtcacttcccagagtcctcctgagccggagcagcaggctggtttaaataggaagaaagct
tccttcgattcctctcctgttttcatcaaagaagcccacaaagagatctcatctgtggcc
ctgctgttctatcagaccagctccaaaccagaacaactccagtacaccattcctgagatg
caaacaaacttattagtcagcaaaatctacagaaaatcatcagaaccaattactgaaatt
ggaatactaacggtcttgcaagctaaacaactgcataggaggccagctcttctctttgcc
accggagatgaactcaaaggaaacgacccggaattaaaggaggtgagacttcgctacggc
ataaagaaaacttgcaaaggcgatagcaaaatcgggtcccatcgaggccatagctactcc
cggaggctttctgcagtacccaccattaaagaccagcttctagaggccctgccttccccc
agatatcccaagcgagggcagaaaattcatctaggagtaggtgtcgggctgctgacagac
tctggggttctgcctaatgatccaatcttccttgatccccaagaagaacttacaatctgc
aaatactatgaaaagagactgttggatttctgttcagtatttaagccggccatgccaaag
tctgttgtgggtactgcctgcatgtacttcaagcgtttctacctcaataactctgtgatg
gaatatcaccctcggataataatgttaacatgtgcatttttggcatgtaaagtagatgag
ttcaatgtatccagcattcagtttgttggaaatgttcgggatagtccttttggacaagag
aaggcccttgaacaaattttggaatatgaacttctacttattcaacaattgaatttccat
cttattgtacacaacccttttagaccattcgaaggcttcctgatagatttaaagacccgc
tatccacttttggaaaaccctgagatcttgaggaaagcagctgatgattttcttaataga
gttgccttgacagatgcttaccttctatttacaccttcacagattgctctcacagccata
ttatctagtgcctccagggctggaattacaatggaaagttatttgtcagaaagcctcatg
ctcaaggaaaatagaacatgtatgtcacagttactggatgtagtgaaatgcatgaaaaac
ctagtgaagaaatacgagtctcccaaaccagaagaagttgctgttctaaaacagaagtta
gagaggtgtcatagctcggaacttgctactaatgtgaatgtgaagaaaagaaaaggctat
gaagatgatgagtatgtctcaaagaaaccaaaactggaggaggaagaatggacagatgac
gatctggtggattctctgtaa

DBGET integrated database retrieval system