KEGG   Ornithorhynchus anatinus (platypus): 100080281Help
Entry
100080281         CDS       T01045                                 

Gene name
PFKP
Definition
phosphofructokinase, platelet
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
AMPK signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100080281 (PFKP)
   01230 Biosynthesis of amino acids
    100080281 (PFKP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100080281 (PFKP)
   00030 Pentose phosphate pathway
    100080281 (PFKP)
   00051 Fructose and mannose metabolism
    100080281 (PFKP)
   00052 Galactose metabolism
    100080281 (PFKP)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100080281 (PFKP)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100080281 (PFKP)
Protein phosphatases and associated proteins [BR:oaa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100080281 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 755 aa AA seqDB search
MNAAVRAVVRMGIYVEAKVYFVYEGYQGMVDGGDNIVEVSWENVSSILQVGGTVIGSARC
KAFRTREGRLKAALNLIQRGITNLCVIGGDGSLTGANLFREEWSGLLEELAREGKIEKEA
VKKYAYLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFIPEYPPEEGWEEQMCTKLSENRARKKRLNIIIVAEGAIDS
LNQPITSEKVKDLVVKQLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEATP
VTPACVVSLCGNQAVRLPLMECVQMTQAVQKAMDERRFNEAVQLRGRSFENNLNTYKLLS
HKKPDAELPTSNFNVAVLNVGAPAAGMNAAVRSAVRVGITEGHKMFAVTDGFEGFSRGQV
KEITWGDVGGWTGQGGSILGTKRTLPAKYLEQIAEQMRTHNINALLVIGGFEAYLGLLEL
SAAREKYDEFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVF
IIETMGGYCGYLANMGGLAAGADAAYIFEEQFDIRELQANVEHLTEKMKTSIQRGLVLRN
ENSNENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAVQWIS
RKLKETYRKGKIFANTDDSVCLLGMRRRNLLFQPVIALKHETDFVHRIPKEQWWLKLRPL
MKILAKYKTSYDVSDSGQLEHVAGCRPQEAETGAI
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgctgtccgggctgtagttcgaatgggaatttatgtcgaagccaaagtgtat
tttgtgtatgagggttatcaaggtatggtggatgggggagacaacattgttgaagtttca
tgggaaaatgtttcaagcattctccaagtgggagggacagtgattggcagtgcccgttgc
aaagcattccggacccgggaaggtcgcttaaaggcagctctcaatttgattcagcgtgga
atcactaacctgtgtgtgattggtggcgatggaagcttgacgggagccaacctctttcgg
gaagaatggagtggactactagaagaattggcacgagaaggcaagatcgaaaaagaggcc
gtgaagaagtacgcctacttaaacatcgtggggatggtcggctccatagacaatgacttc
tgtggaaccgacatgacaatcggcacggactctgccttgcacagaatcatcgaagtggtg
gatgccatcatgaccactgcccagagccatcagaggacctttgtgttagaagttatggga
agacactgtggatatctggccctcgtcagtgccttggcttgcggtgccgattgggtgttc
attcccgaataccccccagaagaagggtgggaagaacagatgtgcactaagctttcagag
aaccgcgcccgcaagaaaaggctgaacattatcatcgtggccgaaggagcgatcgactct
ctcaatcaacccattacgtcagagaaagtcaaagatctcgtggttaagcagctgggattt
gacacccgcgtgactatccttgggcacgtccaaagaggaggtaccccatcagctttcgac
cggattttggccagccgcatgggtgtggaggccgtcctggcccttctggaggcaaccccg
gtcacgccagcttgcgtggtgtccttgtgcggaaaccaggccgtgcgtctgcccctgatg
gagtgtgtgcagatgactcaggctgtgcagaaggcaatggacgagaggagatttaacgag
gccgtgcaactgaggggaaggagctttgagaacaatcttaatacctacaaactgctttct
cacaagaaaccagatgcagaactgccaacgagcaatttcaacgtggctgtcttgaacgtg
ggggctcccgcggcggggatgaacgctgccgtccgctcggcggtgagagtcggcatcacc
gaaggtcataagatgtttgcggtcaccgatgggtttgaaggattctcaagagggcaggta
aaagaaatcacctggggagatgttggaggctggactggccaaggaggatcaattcttggt
accaaacgtaccctccctgcaaagtatttggagcagattgctgaacagatgcgtactcat
aatatcaacgctctattggttattggtggatttgaggcctacctaggactgctggaactg
tcagccgcccgggagaaatatgacgagttctgtgttcctatggttatggtgcctgccacc
gtctccaacaatgtgccgggttcagatttcagcattggcgcagataccgctctgaacact
atcactgatacctgcgatcgcatcaagcagtcggccagcgggacgaagcgccgggtgttc
atcatcgaaacgatgggcggctactgcggttacctggccaacatggggggcctggcagcc
ggggcggacgccgcgtacatcttcgaggagcagttcgacatccgggaactgcaggctaac
gtggaacatttgactgagaagatgaagaccagcatccagcggggcctggtgctcaggaat
gagaacagcaatgaaaattataccactgatttcatctaccaactgtattctgaggaagga
aaaggagtatttgattgcagaaagaatgttttgggccatatgcaacagggtggagcaccc
tcgccatttgacagaaactttgggacaaaaatctccgctaaagccgtgcagtggatttct
agaaaactgaaggagacataccggaaaggaaaaatatttgccaacaccgatgactcagtt
tgtttgctaggaatgcgcagacggaatcttctcttccaacctgtaattgcactaaaacat
gaaacggattttgtgcaccggattcccaaggaacagtggtggttgaaactgaggcccctg
atgaagattctggccaagtacaaaaccagctatgacgtttccgactcgggtcagctggag
cacgtggcggggtgccgaccccaagaagcggaaactggagccatctag

DBGET integrated database retrieval system