KEGG   Ornithorhynchus anatinus (platypus): 100080317Help
Entry
100080317         CDS       T01045                                 

Gene name
USP22
Definition
ubiquitin specific peptidase 22
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100080317 (USP22)
Peptidases [BR:oaa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100080317 (USP22)
Transcription machinery [BR:oaa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100080317 (USP22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 464 aa AA seqDB search
MCQDYIYDKDLEQIAKEEQRKAWKLQAFTPTVVSHYQCTMTGIGEKYSTWEPTKRELELL
RHNPKRRKITTNCTIGLRGLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHKCEMQSPSS
CLVCEMSTLFQEFYSGHRSPHIPYRLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHC
KVDIAKHQDNVRNKTANVVLASMMPSAVQGKPRIMNLAGDDNGKKANNPNHCNCIIDQIF
TGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSDGSVVNGESHVSGTTT
LTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRRK
ITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESGHYT
SFIRQHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcaggattacatatacgacaaagacttggaacaaattgccaaagaagaacaacgg
aaagcttggaaattacaagccttcaccccaacagtggtttctcactaccagtgtacaatg
acaggcattggagagaagtattcaacttgggagccaaccaaacgagagttagaactgcta
cgacacaatcccaagcggaggaaaataaccacaaactgcaccataggtcttcgagggcta
atcaatcttgggaacacgtgttttatgaactgtattgtccaggcacttacccacactcca
ctactgcgagatttcttcctctctgataggcacaaatgtgaaatgcaaagccccagctca
tgtctggtctgtgaaatgtctacactttttcaggagttttactctgggcaccgatctcct
cacattccatataggttattgcacctggtatggacgcacgcacgacatttagcagggtac
gagcaacaagatgcacacgagttcctcattgctgcattagatgtgcttcacagacattgc
aaagttgatattgcaaaacatcaggacaatgtaaggaataaaactgccaacgttgttttg
gcgtcaatgatgccatcagcagtacaggggaaacccaggatcatgaacttagcaggtgat
gataatgggaaaaaggccaacaaccccaaccactgtaactgcatcatagaccaaatcttt
acaggtggactgcagtctgatgttacctgtcaagtctgccatggcgtttccacgactata
gacccgttctgggacatcagtttagacttgcccggctcttcgacaccattctggccgctg
agcccagggagcgacggcagcgtggtcaacggggaaagccacgtttcaggaaccaccaca
ctcacagactgcttacgaaggtttacaaggccggagcatttaggaagcagtgccaaaatc
aaatgtagtggttgccatagctaccaggaatctaccaaacaactcactatgaagaaatta
cctattgtggcctgttttcatctcaaacggtttgaacactcagccaaactgaggcgaaag
atcactacgtatgtctcctttcccttggagctggatatgaccccgtttatggcctccagt
aaagagagcagaatgaatggacagtaccagcagccaacggatagtctcaacaatgataat
aagtattccttgtttgcagtcgtgaatcaccaaggaaccttggaaagtgggcactacacc
agcttcatccggcaacacaaggatcagtggttcaaatgtgacgacgccatcatcaccaag
gctagcattaaggatgtcctagacagcgaaggatatttactgttctatcacaaacagttc
ctggagtatgagtag

DBGET integrated database retrieval system