KEGG   Ornithorhynchus anatinus (platypus): 100080319Help
Entry
100080319         CDS       T01045                                 

Gene name
TPM1
Definition
tropomyosin 1 (alpha)
Orthology
K10373  
tropomyosin 1
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
MicroRNAs in cancer
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    100080319 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    100080319 (TPM1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100080319 (TPM1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100080319 (TPM1)
   05414 Dilated cardiomyopathy (DCM)
    100080319 (TPM1)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100080319 (TPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 357 aa AA seqDB search
MRNLEAAGGLFQMSVVESPWVYLEDHGVAGMTVRHVDPQRLALQPLWLLEPSEAAIMRTI
VTVMLMARCGIPSCSWRDRVLEDLHKAEDSLLAADDTAAKPSTTSPPPRSQLEDELVSLQ
KKLKGTEDELDKYSEALKDAQEKLEVAEKKAMDAEADVASLNRRIQLVEEELDRAQERLA
TALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVAR
KLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKV
LSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacctggaggcagccggtggactcttccagatgagtgtggtggagagtccgtgg
gtgtacctggaggaccatggggtggctggaatgactgtaaggcatgtcgacccacagaga
ttagctcttcagccactgtggctgttggaaccttcggaagctgctattatgagaacaatt
gtcactgttatgttaatggcccggtgtggaatccccagctgctcatggcgggaccgggtg
ctggaggacctgcacaaggccgaggacagtctgctggcggcggacgacacggccgccaag
ccctcgaccacctccccgcccccacgctcccagctggaggacgagctggtctccctgcaa
aagaagctcaagggcacggaggatgagctggacaagtactccgaggccctcaaagatgcc
caggagaagctggaggtggcggagaaaaaggccatggatgctgaagccgacgtagcctct
ctaaacagacgcatccagctggttgaggaagagttggaccgagctcaggagcgtctagcc
actgcacttcagaagctggaggaggcagagaaggcagcagatgagagcgagagaggaatg
aaagtcattgaaagcagagcccaaaaagatgaagagaaaatggaaatccaggagatccag
cttaaagaggccaagcacattgctgaggatgcggaccgcaagtatgaagaggtggcccgt
aaattggtgattattgaaagtgacctggagcgtgccgaggagcgcgcggagctctcggaa
ggcaaatgtgccgagcttgaagaagagttgaaaactgtgaccaacaatctgaagtcactg
gaggctcaggctgagaagtactcacagaaggaagacaaatatgaggaggagatcaaggtc
ctctctgacaaactgaaggaggctgagaccagagctgagtttgctgagaggtcagtaacc
aaactggagaagagtatcgatgacttagaagatgagttgtacgctcagaaactgaagtac
aaagccatcagcgaggagctggaccacgctctcaacgatatgacttcaatataa

DBGET integrated database retrieval system