KEGG   Ornithorhynchus anatinus (platypus): 100080324Help
Entry
100080324         CDS       T01045                                 

Gene name
BCKDK
Definition
branched chain ketoacid dehydrogenase kinase
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.4  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase
     100080324 (BCKDK)
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100080324 (BCKDK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 365 aa AA seqDB search
MLLATMLASGPRGPLLLPLLSPALRFRSTSATDVHHAELARERSKTVTSFYNQSAIDVAA
EKASVRLTPTTMLYSGRSQDGSHLLKSARYLHHELPVRIAHRIKGFRSLPFIIGCNPTIL
HVHELYIRAFQKLSDFAPIKDQAAEAQYCQLVRQLLDDHKDVVTLLAEGLRECRKHIQDE
KLVRYFLDKTLTSRLGIRMLSTHHLALHEDKCLGLGAGHLLLSPRRCLSPAPNHPPPRRR
LCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNAMRATMESHLDTPYNVPDIVI
TIANNDIDLIIRISDRGGGIPHHHLEKVMDYHFTTAEASAQDPRINPLFGQMDMNSSGQT
GPMHG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggcgacgatgttggcgagtggcccgcgggggcccctgctcctgcctctcctc
tcgcccgcccttcgcttccgctctacctcagccaccgacgtgcaccacgcggagttggcc
cgggaacgatccaagaccgtgacctccttctacaaccagtcggccatcgacgttgcggcc
gagaaggcctcggtccgtctcaccccgacaacgatgctgtattctggacgatcgcaggat
ggcagccacctgctgaaaagtgcccgatacctccaccacgagctccccgtccgcattgct
caccggatcaagggtttccggagtttgcccttcatcatcggctgcaatcccactatccta
catgtgcatgaactctacatccgggccttccagaagctcagtgactttgctccgatcaag
gatcaggcggctgaggctcagtactgtcaactagtgcgtcagctcttggatgaccacaag
gatgtggtgaccctgctggctgaaggtctacgggaatgccgaaagcacatccaggatgag
aagctggtccggtatttcctggataagactctgacctcgcggctcggaattcgaatgttg
tcaactcaccacctggccctccatgaagataagtgcctggggctgggggcgggacacctg
ctgctcagtccccgcagatgccttagccctgcccccaaccaccctcctccccgcaggcgc
ctgtgtgaacacaagtacgggaacgccccgcgggtccggatcaacgggcacgtggccgca
cggttcccgttcatcccgatgccgctggattacatccttcccgagctgctcaagaatgct
atgagggctacgatggagagccacctagacactccctacaacgttcccgatatcgtcatc
accatcgccaacaatgacatcgacctgatcataaggatctcggaccggggcgggggcatc
ccccaccaccacctggagaaagtcatggattaccacttcaccacggcggaggccagcgcc
caggacccccggatcaaccctctcttcggacaaatggacatgaacagcagtggccagacc
ggccccatgcatgggtga

DBGET integrated database retrieval system