KEGG   Ornithorhynchus anatinus (platypus): 100080358Help
Entry
100080358         CDS       T01045                                 

Definition
protein-arginine deiminase type-3-like
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     100080358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 385 aa AA seqDB search
MPLQRIVRVSLEHPTSAVCVAGVETIVDIYGSVPEGTTSFEVYNSPGVDVYISPNMDTSR
QRAGRKRWLFDVGLEIIVVMKSPSKDLNDSHIQISYHSEGEDAALAYAVLYLTCVDISLD
ADADCDGKVERSYSNKNNWIWGPKGLGAILLVNCDRDDLDGAKRDNCDQCVGSLEDLKDM
SLMILRTYGPSALFDDYKLVLHTSSSDVEKARVFHACASEDACQNYKHVLGQDKVSYVVE
RCHGDEEMFYVEGLCFPDAGFSGLISFHVTLLDDSNQDFPESPIFTDTVVFRVAPWIMTP
STLPPLEVYVCRVRNNTYFVDAVAALARKAGCKLTICPQTENRNDRWIQDEMELGYIQAP
HKTFPVVFDSPRNGELQDFPYKRIL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcagaggatcgtccgggtgtccctggagcaccccactagcgccgtgtgtgtg
gccggggtggaaaccattgtggatatctacgggtcagtcccggagggcaccacatcattt
gaagtctacaacagcccgggagtggacgtttacatttcccccaacatggacacgtcccga
caacgggctgggagaaagaggtggctttttgacgtggggctggagatcatcgtggtcatg
aagtctcccagcaaagacctcaacgacagccacattcaaatttcctaccactctgagggc
gaagatgctgccttggcctatgctgttctgtacctcacctgtgtcgacatctctctggac
gcggatgcagactgtgatgggaaggtggagaggagctattccaacaagaataattggatc
tggggccccaaaggactaggggccatcctactggtgaactgtgaccgggacgatctggac
ggcgccaagagagacaactgtgaccagtgtgtgggcagcctagaagacctgaaggacatg
tcgctcatgatcttgaggacgtatggtccttctgctctctttgatgactacaaattagtt
cttcacacatccagctctgacgtggagaaagccagagtcttccatgcctgtgcctctgag
gacgcctgccaaaactataaacacgtgttagggcaggacaaagtctcctacgtggtggag
cgatgccatggagatgaggagatgttctatgtggaagggctgtgtttcccggatgcgggc
ttttcgggactgatctcctttcacgtcactctgctggacgattcaaatcaggattttccc
gaatctccaattttcacggacacagtggtgttccgagtggccccctggatcatgacccca
agcacgctccccccgctggaggtgtatgtgtgcagggtgaggaacaacacctactttgta
gatgcggtagcggcattggccaggaaagcaggctgcaagctgaccatctgtcctcagaca
gagaatcgcaacgatcgctggatccaggatgagatggagttgggctacatccaagctccc
cacaagaccttccctgttgtcttcgactccccaaggaatggagaactacaggatttccct
tacaaaagaatcctg

DBGET integrated database retrieval system