KEGG   Ornithorhynchus anatinus (platypus): 100080385Help
Entry
100080385         CDS       T01045                                 

Gene name
USP47
Definition
ubiquitin specific peptidase 47
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1530 aa AA seqDB search
MDVHLGAEDEGSKACVSKSKGNAEGRKGVGEVKAESEKASQKKSDFNKALKTRPRANPAP
STVVHRRFVCARTLLVENEPEGMKGKTRPRANPAPSTVVHRRFVCACTLLVENEPEGMKE
KVRGLEQREKQGGDAGTLWLVAGRGEGSAAFPEWAAFSEIPIALESKKTDAGALEEAEEL
LGSGVMKLKVENAAEEPRILCIIQDTTNSKTANERLTLNLPASTPLKKLFEDVASKLGYI
YGTFDLAWGNGIVVAALPPLDHTSERSLLDNNFEPGKKNFLHLTDKEGEQPQIMSVISAA
MDDSAQDRFIGPLPREGSLGSANDYVSQNYSYSSILSKSETGYVGLVNQAMTCYLNSLLQ
TLFMTPEFRNALYKWEFEEAEEDPVTSIPYQLQRLFVLLQNSKKRAIETTDVTRSFGWDS
SEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKLKDYVRCLECGYEGWRIDTY
LDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHFPY
LLTLQLKRFDFDYTTMHRIKLNDRMSFPEELDMSTFIDVEDEKSPQTESCTDSGAENEGS
CHSDQMSNDFSNDDGVDEGICLESNSGTEKVSKPGLEKHSLLYELFSVMVHSGSAAGGHY
YACIKSFSDEQWYSFNDQHVSRITAEDIKKTHGGSSGSRGYYSSAFASSTNAYMLIYRLK
DPARNAKFLEVNDYPEHIKNLVQKEKELEEQEKRQREIERNTCKIKLFCMHPVKQLMMEN
RLEVHKDKTLKEAIEIAYKVMELEDVIPLDCCRLVKYDEFHDYLERSYEGEEDTPMGFLL
GGVKSTYMFDLLLETRRFDQVFQSYKPGEVMVKVHVVDLKAESVAAPISVRAYLNQTIIE
FKQLVSKALLLPTETMRIVLERCYNDLRLLNVPSKTLKAEGFFRSNKVFVESSESSDRQL
AFADSHLWKLLDRHANTIRLYVLLPEQSPGSHSKRTACHKASGDSGQTNDACERAKGPVG
SQKSVEAILEESTEKLKNLSLRQRREGGDGASRKDAETADLETGESSLTERASAAAGHRD
LEPPVQTSDPENFPSEERSDSDVNTDRSTSSVDSDILSSSHSSDTLCNADSTPGPLANGL
DSHSITSSRRSKANEGKKETWDTAEEDSGTDSEYDESGKSGGAVQYMYFKAESLAADDGA
GEGHRWLLVHVDKRITLAAFKQHLEPFVGVLSSQFKVFRVYASNQEFESVRLNETLSSFS
DDNKITIRLGRALKKGEYRVKVYQLLVNEQEPCKFLLDAVFAKGMTVRQSKEELLPQLRE
QCGMDINIDRFRLRKKTWKNPGTVFLDYHVYEEDINISSNWEVFLEVLDGVEKMKSMSQL
AVLSRRWKPSEMQLEPFQEVVLESSSVDELKEKLCEISGIPLEDIEFAKGRGTFPCDISV
LEIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEEPMELSDEQRNELMKRESSRLQK
TGHHVTYSPRKEKALKIYLDGAPSKESTQD
NT seq 4593 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgcacctaggtgctgaggatgaggggagtaaagcgtgcgtatccaagagcaag
ggaaacgcagaagggagaaagggggtcggggaagtgaaggctgagtccgagaaggcctct
cagaagaaaagcgattttaataaggctttgaagacccgacccagagctaacccagcaccc
tcaacagtggttcatcgacgttttgtgtgtgcacgcaccctccttgtggagaatgaacca
gaagggatgaagggaaagacccgacccagagctaacccagcaccctcaacagtggttcat
cgacgttttgtgtgtgcatgcaccctccttgtggagaatgaaccagaagggatgaaggaa
aaggttcggggcctggagcagagggaaaagcagggaggtgatgctggaactttatggcta
gtggcggggagaggggaaggaagtgctgcttttccagagtgggctgcattttcagaaatc
cctatagctctggaaagcaaaaaaacagatgctggtgctctggaagaagctgaagagctt
ctgggaagtggtgtcatgaagctgaaagtagaaaatgctgctgaagagcccagaatcttg
tgtatcattcaagatactacaaattccaagacagcgaatgaacgactcactttaaactta
ccagcttccacaccactgaaaaagctgtttgaagatgtggccagcaaactgggatatatt
tatggaacctttgatttggcctggggaaatggaattgttgttgctgctttgccacctttg
gatcacaccagcgagaggtcgcttctggataataattttgagccagggaagaagaatttt
ctgcacttgacagataaagagggtgaacagcctcagataatgtcggtgatctctgctgca
atggatgacagtgcccaagataggtttataggtcctctcccaagagaagggtccctgggt
tctgccaacgattatgtcagtcaaaactactcttattcttctatcctgagcaaatccgaa
acaggatatgtgggattagtaaatcaagctatgacgtgctatttgaacagccttttgcaa
acacttttcatgactcctgaatttagaaatgcattatataagtgggaatttgaggaagct
gaagaggatccagtcaccagcatcccttatcagcttcaaaggctatttgttttattgcag
aacagcaaaaaaagagcaatcgaaacgaccgatgttacaaggagctttggatgggatagt
agtgaggcttggcagcagcatgatgtacaagaactttgtagagtcatgtttgatgctttg
gaacaaaagtggaagcaaacggaacaggccgatctcataaatcaactttatcaaggcaag
ctgaaggactacgtgcgatgcttggaatgcggttatgagggctggagaatcgacacgtac
ctggatatcccactggtcatccgaccgtacggctccagccaggcatttgctagtgtggaa
gaagcactgcatgcgttcattcagccagagatcctggatggccccaatcagtacttctgt
gaacgctgtaagaagaaatgtgacgcccggaaggggctgcgatttttgcatttcccatat
ctgctgaccctgcagttgaaaaggtttgacttcgattacaccaccatgcataggattaaa
ttaaacgatcgcatgagtttccctgaggagctagacatgagtactttcattgacgttgaa
gatgagaagtctccgcagacggagagttgcactgatagtggagctgaaaatgaaggcagc
tgtcacagtgatcagatgagcaatgatttctccaatgatgatggagttgatgaaggaatc
tgtcttgaaagtaacagtgggacggaaaaggtttctaaacctggccttgagaagcattcc
ttgctgtatgaactcttttctgttatggtgcattcgggaagtgccgccggtggccattat
tatgcctgcataaaatcattcagcgatgagcagtggtacagcttcaacgaccaacacgtt
agcaggataactgcagaggacattaaaaaaacccatggtgggtcttcaggaagcagaggg
tattactcaagtgcttttgcaagctccacaaacgcatatatgcttatatatagactgaaa
gacccagcaagaaatgcaaagtttttagaagtgaatgattatccggagcacattaagaat
ttggtgcagaaggagaaagagttggaagagcaagaaaagaggcaacgggaaattgagcgc
aatacttgtaagatcaaattgttctgcatgcatccggtgaaacagctcatgatggagaat
agattagaggttcataaggataagaccctgaaggaggcaatagaaatagcctataaggtg
atggaattggaagacgtcattcctctggattgctgccgtcttgttaagtacgatgagttt
cacgattatcttgagcggtcctatgaaggagaggaagacaccccgatgggattcctatta
ggcggagttaagtcaacctacatgtttgatctgctgctggaaacgagaagatttgaccag
gttttccagtcttacaaacctggggaggtgatggtgaaagttcacgtggtcgacttaaag
gcagaatccgttgccgcccctatcagtgtgcgagcttatttgaatcaaacgataatcgag
tttaaacagcttgtctcaaaggctttattactccctactgaaacaatgcgaatagtcctg
gaacgctgctataatgacttgcgtcttctcaacgtgcccagtaaaacactgaaggccgaa
gggttttttagaagcaacaaggtgtttgtcgagagttccgagtcttcggatcgtcagctg
gccttcgccgactcccacttgtggaagctcttggatcggcacgcaaatacaatcagactc
tatgttttgttgccagagcagtccccggggtctcattctaaaaggacagcttgtcacaaa
gccagcggagattctggccagacaaacgacgcttgcgaaagagcgaaaggacccgtaggg
agccaaaagtctgtcgaggcgatcctcgaagaaagcaccgagaagctcaagaacctgtcg
ctgcgacagcggcgggagggaggggacggggcgagccgcaaggacgccgagaccgccgac
ctggaaaccggcgagtcgtctctgaccgagagggcctcggcagcggcggggcatcgagac
ctcgagcccccggttcagacctcggacccggagaacttcccgtcggaggagcgctcggac
tctgacgtgaatacggacaggagcaccagctccgtggacagcgacatcctcagctccagt
cacagcagcgacaccctgtgcaacgcggacagcaccccgggccccctggccaacggactc
gactctcacagcatcacgagtagcaggaggtcgaaagccaacgaggggaaaaaagagacc
tgggacacggcggaagaagactcggggacggacagcgaatacgacgagagcggcaagagc
ggcggggcggtacagtacatgtacttcaaagcagaatccttggccgccgatgacggtgcg
ggggaagggcacagatggctgttggtgcatgttgataaacgaatcactctggcggccttc
aaacaacatttggaaccttttgttggagttttgtcctcccagttcaaggttttccgagtt
tatgccagcaatcaagagtttgagagcgtgcgactgaatgagaccctttcatcattttca
gatgacaacaagatcactattcgactgggcagagcgcttaagaagggcgaatacagagtg
aaggtataccagcttttagtgaatgagcaagagccatgcaagtttctgctcgatgctgtg
tttgctaaaggaatgacggtcagacagtccaaagaggagctgctccctcaactcagagag
cagtgcgggatggatatcaacatcgacaggtttcgtctaaggaagaaaacgtggaagaat
cccggcacggtatttctggattatcacgtctacgaagaggatattaacatctccagcaac
tgggaggtgttccttgaagttctcgatggggtggagaagatgaaatctatgtcccagctt
gccgttctgtcgagacgatggaagccctcggagatgcagctggaacccttccaggaagtc
gtgctggagagcagcagtgtcgatgagttgaaagagaagctctgtgagatcagcggaatt
cctttggaagacatcgaatttgcaaagggcagaggaacgttcccctgcgacatttcggtc
ttggagattcatcaggacttggattggaatcctaaagtgtcgactttgaatgtttggccc
ctctacatctgtgatgatggagcagtgatattttatagggataagacggaagaaccgatg
gaactgtcggacgagcagagaaacgaactgatgaaaagggaaagcagccggctccagaaa
accgggcatcacgtcacctactcccctcggaaagaaaaggcactaaaaatctatctggat
ggggcacccagtaaggagtcgactcaagactga

DBGET integrated database retrieval system