KEGG   Ornithorhynchus anatinus (platypus): 100080435Help
Entry
100080435         CDS       T01045                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 180 aa AA seqDB search
SDSTLKKFLEESISMSPEERAKYLEKYEAIRVTHESSAHEGQTESSSPSSSQPHSSHCRT
KASPLCHHASLPWVKRNHVGPAKATSPSLRLRRWRPFLRLPSVGLHSVAPSIDEKVDLHF
IALVHVEGHLYELDGRKPFPINHGETSDDTLLEDAIEVCKKFMERDPEELRFNAIALSAA
NT seq 545 nt NT seq  +upstreamnt  +downstreamnt
aatctgactcaaccctgaaaaaattcttggaggaatctatatctatgagtcccgaagaaa
gagccaaatacctagaaaaatatgaagctattcgagttactcacgaatccagtgcccacg
aaggccaaacagagtcgtcctcgccatcctcatcacagcctcattctagccactgcagaa
cgaaggcctcaccattgtgtcaccatgcatccctgccttgggtcaaacgtaaccatgtag
gtcctgccaaagctaccagtccatctctccgtcttcgtcgctggcggcccttcttacgcc
taccatctgtggggctccattctgttgcaccaagtatagatgagaaagtagatctgcatt
ttattgcattagttcacgtagaaggtcatctctatgaattagatggacgcaaaccttttc
caataaaccatggggagactagtgatgacactttattagaggatgcgatagaagtttgca
agaagttcatggaacgtgacccagaggaattacgatttaacgcaatagctctatctgctg
catag

DBGET integrated database retrieval system