KEGG   Ornithorhynchus anatinus (platypus): 100080539Help
Entry
100080539         CDS       T01045                                 

Gene name
MAPK15
Definition
mitogen-activated protein kinase 15
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100080539 (MAPK15)
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   100080539 (MAPK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 286 aa AA seqDB search
PCLSPQEFADHPNIIKLLDVIRAENDKDIYLVFETMETDLHAVIKKGTLLKDIHKSYILY
QLLKASKFLHSGNVIHRDQKPSNVLLDAACSVKLCDFGLARSLRQLHREPGSPALTEYVA
TRWYRAPEILLSSPRYTPGVDMWSIGCILGEMLLGKPLFPGTSTINQLEHILRVIPVPSH
QDLLAIQSNFSASVINRMCPKHAHTAGRGIRGLRTRHNSAAPVPGQQRGTSATGRGGRPP
ANKNSATSHPAPSHDAPTWVEFRRGRPAEKTFVGKSINKDKSGLGV
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gaccctgtctgtccccacaggagtttgcagaccaccccaatatcatcaagctcttagatg
tcatccgggcagagaacgacaaggacatctaccttgtctttgagactatggaaacagacc
tgcatgccgtgatcaagaaggggaccttgctgaaagacatccataagtcttacatcctgt
accagctgctgaaagcctccaagttcctccactcgggcaatgtcattcaccgggaccaga
agccctccaacgtgctcctggatgcggcctgctccgtgaagctctgtgacttcggcctgg
cccgctcgctgcgccaactgcaccgggagccgggcagcccggccctgaccgagtacgtgg
ccacccgctggtaccgggcccccgagatcctcctgtcatcccctcggtacacgccgggcg
tggacatgtggagcattggctgtatcctgggggagatgctgctggggaaaccgctgttcc
ccgggacgtccaccatcaaccagctggaacacatcctcagggtcatcccggtcccttccc
accaggacctcctggcgatccaatccaatttcagcgcttcggtcatcaaccgcatgtgcc
caaagcacgcacacaccgctggcaggggcataaggggcctcaggaccaggcacaactcag
cggcccctgtgcccgggcagcagagaggcacatctgccaccgggagagggggcaggccac
ctgccaacaagaactcggccaccagccatcccgcccccagccacgatgccccgacctggg
tggagttcagaagagggagaccagctgagaagacttttgtgggcaagagcatcaacaagg
acaaaagtggcctgggagtgg

DBGET integrated database retrieval system