KEGG   Ornithorhynchus anatinus (platypus): 100080787Help
Entry
100080787         CDS       T01045                                 

Definition
3'(2'),5'-bisphosphate nucleotidase 1-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:oaa00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 308 aa AA seqDB search
MASNPTVLMRLVASAYSIAQKAGTIVRNVMAAGDLDIVEKTSASDLQTKADRLVQMSICS
SLARKFPKLTIIGEEDLPFQDVDQELIESGQWDEILKKPCPVQYSSIKEEDLVVWVDPLD
GTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYQAGSGAVLGRTIWGILGLGAFGF
QLKEVPAGKHIVTTTRSHSSKLVNDCVDAMNPDLVLRVGGAGNKIIQLIEGKASAYVFAS
PGCKKWDTCAPEVILHAVGGKLTDIHGNPYQYDKDVKHMNSAGVLATLRNYDYYASRIPD
AVKKELLP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaacccaactgtgttgatgcgcctagtagcctctgcctactccattgcccag
aaagccggaacaatagtcagaaatgtcatggctgcaggagacctggacatcgtggaaaag
acgagtgcttcagacctgcagaccaaagcagaccgattggtccagatgagtatatgctcg
tcattggcacgaaaattccccaaattgacaattataggtgaagaggacctaccctttcaa
gatgtggatcaagagctgattgagagtggccagtgggatgaaattttgaagaaaccttgt
cccgtgcagtacagttctatcaaagaggaagatctggtcgtttgggtcgaccctctggat
ggcaccaaggaatacactgaaggtcttcttgacaatgtcacagtccttattgggattgca
tatgaagggaaagcaatagcaggtgttatcaaccagccctactacaactatcaggcagga
tcaggtgccgtgttgggaaggacaatatggggcattttgggcttgggagcctttgggttt
cagctcaaagaagtgcctgctgggaagcatattgtcaccactacccgctcccacagtagc
aagttggtaaacgactgcgttgatgccatgaaccctgatcttgtgctgagagttggagga
gcaggaaataagataattcagcttattgaaggaaaggcctctgcttatgtatttgccagt
cctgggtgcaaaaagtgggatacatgtgctcctgaagtcattttgcatgcggtgggaggc
aagctaaccgatatccatggcaatccatatcaatatgacaaggatgtaaagcacatgaat
tcagcaggagtccttgccactttgagaaattatgactactatgcaagtcgtatcccagac
gccgttaaaaaagaacttttgccgtaa

DBGET integrated database retrieval system