KEGG   Ornithorhynchus anatinus (platypus): 100081052Help
Entry
100081052         CDS       T01045                                 

Gene name
GALC
Definition
galactosylceramidase
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100081052 (GALC)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100081052 (GALC)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     100081052 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 260 aa AA seqDB search
MTSNIFSSTISWNLLASYYEQLPYGRDGLMTAQEPWSGHYVVETPIWISAHTTQFAQPGW
HYLKTVGHLKKGGSYVALTDGMGNLTIIIETMSHNHSRCIRPPLPAFTVSAQNATFSLKG
SFNDLKTLQVWYSKLEYKSANSILFKPLTPLKLNESSFTLSLDVDEIYSLTTITTGHKGS
YPVPPKSQPFPPTYKDDFDVRDPPFSEAPNFADQTGVFEYFINISDPGEHIYTLRQVLTQ
RPITWASDADQTISIIGDYK
NT seq 782 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaaacatattttccagcacgatctcttggaacttgttggctagttactatgaa
caactgccttatggtcgggatggattgatgacagctcaggagccatggagtggccattat
gtagtagaaacacctatctggatttcagctcatactacccaatttgctcaaccaggttgg
cattacctgaaaacagttggccacttaaagaaaggaggaagctatgtagctctaacagat
ggcatgggaaacctcactataataattgaaactatgtctcataaccattctaggtgcata
agaccaccccttcctgcttttaccgtgtcagcgcagaatgcaaccttctcccttaaagga
tcttttaatgatctgaaaacacttcaggtgtggtattccaaactggaatacaaatctgcg
aactccattttattcaaaccactgactcctctaaagttgaatgaaagctcattcacctta
tccctggatgtggatgaaatctattctttaacaactataactacagggcataaaggcagt
tacccagttcctcccaaatcacaaccatttcctcctacatacaaggatgattttgatgtc
cgtgatccacctttcagtgaagctccaaattttgctgatcaaacaggagtgtttgagtat
tttataaatatttcagaccctggtgagcatatttacacattacgccaggtgcttactcag
cgtcccatcacctgggcctctgacgcagaccagaccatcagtattataggagattataaa
tg

DBGET integrated database retrieval system