KEGG   Ornithorhynchus anatinus (platypus): 100081052Help
Entry
100081052         CDS       T01045                                 

Definition
galactocerebrosidase-like
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:oaa00600]
Cellular Processes; Transport and catabolism; Lysosome [PATH:oaa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 449 aa AA seqDB search
MSEKSHMIAHIYDGTVLLHIHIDKSILGVKDSKPMYDHGHSKTVSWNYRVELANGLIQYD
NFYICMFLDQVYLASSEKAYVIIFSYCLTSLKEGLHTFAGLLRSILDKQDLEQVRIIASD
NLWQPISYFLLLDSDLHGVVDVIGAHYPGTRTVEDALKTKKKLWSSEDYSTFNDEIGGGC
WARILNQNYINGHMTSTISWNLLASYYEQLPYGRDGLMTAQEPWSGHYVVETPIWISAHT
TQFAQPGWHYLKTVGHLKKGGSYVALTDGMGNLTIIIETMSHNHSRCIRPPLPAFTVSAQ
NATFSLKGSFNDLKTLQVWYSKLEYKSANSILFKPLTPLKLNESSFTLSLDVDEIYSLTT
ITTGHKGSYPVPPKSQPFPPTYKDDFDVRDPPFSEAPNFADQTGVFEYFINISDPGEHIY
TLRQVLTQRPITWASDADQTISIIGDYKW
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaaaaagtcacatgatagcccatatatatgatggaacagtattgcttcatatt
cacatagataaatctattctgggggtcaaagacagcaaaccaatgtatgaccatggacac
tccaagactgtctcttggaactatagggttgaattggccaatggtttgattcagtatgac
aatttttacatttgcatgttcttagaccaagtatacctggcaagtagtgaaaaggcttat
gtcatcattttttcttactgtttaacctccctaaaggaaggtttacatacatttgcaggg
ctgctaagaagcattctggataagcaagatctggagcaagtgaggatcatagccagtgat
aacctctggcagccgatttcatattttctgctgcttgactctgatctccatggagtagtg
gatgttataggggctcattatcctgggacccgcactgtagaagatgctctaaagaccaag
aagaaactctggtcttctgaagattacagtactttcaatgatgaaatcggtggaggttgc
tgggcacgcatcttgaaccagaattacataaatggacacatgacttccacgatctcttgg
aacttgttggctagttactatgaacaactgccttatggtcgggatggattgatgacagct
caggagccatggagtggccattatgtagtagaaacacctatctggatttcagctcatact
acccaatttgctcaaccaggttggcattacctgaaaacagttggccacttaaagaaagga
ggaagctatgtagctctaacagatggcatgggaaacctcactataataattgaaactatg
tctcataaccattctaggtgcataagaccaccccttcctgcttttaccgtgtcagcgcag
aatgcaaccttctcccttaaaggatcttttaatgatctgaaaacacttcaggtgtggtat
tccaaactggaatacaaatctgcgaactccattttattcaaaccactgactcctctaaag
ttgaatgaaagctcattcaccttatccctggatgtggatgaaatctattctttaacaact
ataactacagggcataaaggcagttacccagttcctcccaaatcacaaccatttcctcct
acatacaaggatgattttgatgtccgtgatccacctttcagtgaagctccaaattttgct
gatcaaacaggagtgtttgagtattttataaatatttcagaccctggtgagcatatttac
acattacgccaggtgcttactcagcgtcccatcacctgggcctctgacgcagaccagacc
atcagtattataggagattataaatggtaa

DBGET integrated database retrieval system