KEGG   Ornithorhynchus anatinus (platypus): 100081100Help
Entry
100081100         CDS       T01045                                 

Gene name
GBE1
Definition
glucan (1,4-alpha-), branching enzyme 1
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100081100 (GBE1)
Enzymes [BR:oaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     100081100 (GBE1)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100081100 (GBE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 680 aa AA seqDB search
MHLGKDSLVASSHGSLSSRNSQSPDYDIFIEYGWTVGLIPCVDLRQLGKQTRVKVYKLFS
QHLKNIEQSEGGIDKFSKSYESFGIHRCADGGLYCKEWAPEAEGVFLTGDFNGWNPFSFP
YKKLEFGKWELHIPPQQNKSSPVPHGTKLKVVITSKSGRILYRISPWAKYVIREGDKVNY
DWIHWDPEQSYQCKHSRPKKPRSLRIYECHVGISSHEGKVASYKHFTCNVLPRIKNLGNR
FGTPEELKELVDTAHSMGITVLLDVVHSHASKNSEDGLNQFDGTDACYFHSGPRGNHDLW
DSRLFAYSSWEVLRFLLSNLRWWLEEYGFDGFRFDGVTSMLYHHHGMGQGFSGDYNEYFG
LQVDEDALVYLMLANHLVHAVYPDCITIAEDVSGMPALCAPISQGGGGFDYRLAMAIPDK
WIQIIKEFKDEDWNMGNIVHTLINRRYLEKCIAYAESHDQALVGDKTLAFRLMDAEMYTN
MSVLSPLTPVVDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRAGNNESYHY
ARRQFHLADDELLRYKFLNAFDRDMNKLEERCGWLSAPQAYVSEKHEENKIIAFERANLL
FIFNFHPVKSYTDYRVGTSSPGKFKIVLDSDEAEYGGHQRLDHNTDFFSGHFEHNSRPCS
LLVYIPSRVAIVLQNMDLPN
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgcatttgggaaaggacagtctagtagctagtagccatggatccttgtcctcaaggaac
tcacagtccccagactatgacatcttcattgaatatggttggacagtgggacttataccc
tgtgtggacctgagacaactagggaaacaaactagagtcaaggtgtacaaactgtttagc
cagcatttgaagaacattgaacaaagtgaaggtggcattgataaattctccaaaagttac
gaatcattcggcattcatagatgtgcagatggcggcctgtactgcaaggaatgggcaccg
gaagcagaaggtgtttttctaactggagattttaatggttggaatccattttcttttcca
tataaaaaactggaatttgggaaatgggagctgcacattccaccacagcagaacaaatct
tcacctgtaccccatggaacaaaattaaaggtggttatcactagtaaaagtggacgtatc
ctctatcgaatttcaccatgggcaaagtatgtgattcgtgaaggtgataaggtgaattat
gattggatacactgggacccagagcaatcatatcaatgcaaacattctcgaccaaagaag
ccacgaagtttaaggatctatgaatgtcatgtaggaatttcttctcatgaaggaaaagta
gcttcatataaacactttacatgtaatgtcctaccgagaataaagaaccttggtaaccgt
tttggaactcctgaagaactgaaggaactcgtagacactgctcactcaatgggcatcaca
gttctcttggatgttgtacacagtcatgcatctaaaaactctgaagatggtctgaatcag
tttgatggcaccgatgcttgttatttccattctggccctagaggaaatcatgatctctgg
gacagtagactctttgcctattcaagctgggaagttttgcgattcctcctttctaatttg
agatggtggttagaagaatatggttttgatggtttccgttttgatggtgtaacatccatg
ctttatcaccaccatggaatgggtcaaggtttttcaggtgattacaatgaatattttgga
ttgcaagtggatgaagatgccctagtttatctcatgctagcaaaccatctggttcatgca
gtgtatccagattgtattacaatagctgaggatgtttcagggatgccagctttgtgtgct
cctatttcacaaggaggtggtggattcgactatcgattagccatggcaattcctgataaa
tggatccagataattaaagagttcaaagatgaagactggaatatgggtaacattgtgcat
acccttataaaccgacgctaccttgaaaaatgcatcgcatatgctgaaagtcatgatcag
gcccttgttggtgataagactttggcatttcggttgatggatgcagaaatgtacacaaac
atgagcgtgctgtctcctcttactccggttgttgatcgtggaattcagcttcacaagatg
attcgcctgattactcatggactagggggagaaggctatctcaacttcatgggtaatgaa
tttggccatccagaatggttagacttcccaagggcaggaaacaatgagagttaccattat
gccaggagacagtttcatttagctgatgatgagctgcttcgctataaattcctgaatgcc
tttgacagagatatgaataaattggaagaaagatgtggctggctttcagctccccaggca
tatgtgagtgaaaagcatgaagagaataagatcattgcttttgagagggcaaatctcctt
tttattttcaattttcatcctgtaaaaagctatactgactacagagtgggtacatcatca
ccaggaaaattcaaaattgtactggattctgatgaagcagaatatggaggacatcagagg
ctggaccacaatacagatttcttctctggtcactttgaacataatagccgtccatgttca
cttttggtctacattccaagcagagtggctattgtgctccagaacatggatctcccaaac
tga

DBGET integrated database retrieval system