KEGG   Ornithorhynchus anatinus (platypus): 100081142Help
Entry
100081142         CDS       T01045                                 

Gene name
BDNF
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
MAPK signaling pathway
cAMP signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100081142 (BDNF)
   04024 cAMP signaling pathway
    100081142 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    100081142 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100081142 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    100081142 (BDNF)
   05034 Alcoholism
    100081142 (BDNF)
Cytokines [BR:oaa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    100081142 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 318 aa AA seqDB search
FLHVXARVILVSSWNXSSPQKGIRVHTCFGVYPHTSIXTSEKERRLYLCASVKLSQQISE
NGLIKFHQVRRVMTIFFLTMVISYFSCMKAAPMKEASVRGKGSLAYPGLRTHGTLEGLSG
PQPGSRGLTSLANTFEHVIEELLDEEQSVQPSEENKDADLYTSRVMLSSQVPLEPPLLFL
LEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEK
VPVPKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDNKKRVGWR
FIRIDTSCVCTLTIKRGR
NT seq 958 nt NT seq  +upstreamnt  +downstreamnt
ttttctccatgtgtgagcaagggtaatcctcgttagctcttggaacnnatcgtctcctca
gaaagggatacgtgtccacacatgttttggcgtctacccacacacttctatannaacatc
agagaaggagagacggctgtacctgtgcgcttcagtgaaacttagccaacagatctctga
aaatggtctcataaagttccaccaggtgagaagagtgatgaccatctttttccttactat
ggttatatcatacttcagttgcatgaaggctgccccaatgaaagaagccagtgtcagagg
gaaaggcagtttagcctaccctggtcttcggacccacgggaccttggagggcctcagcgg
tccccagcctgggtcgagaggactgacgtcgttggccaacacttttgaacatgtgatcga
ggagctcctggacgaggagcagagcgtccagccgagtgaggagaacaaagatgcagactt
gtatacgtctcgggtgatgctaagcagtcaagtgcctttggagcccccgctgctctttct
gcttgaggagtacaaaaattacttggatgcggccaacatgtccatgagagtccgacgcca
ctctgaccccgcccgccgtggggagctgagcgtgtgtgacagtatcagcgagtgggtcac
ggcagcggacaagaagacggctgtggacatgtcgggtggaacggtcacggttctcgaaaa
agttccggtccccaaaggccaactgaagcaatacttctacgagactaagtgcaacccaat
gggctatacaaaagagggttgtcggggcatagacaagaggcactggaattcccagtgccg
aactacccagtcctacgtacgggccctcacgatggataataaaaaaagagttggctggcg
gttcataagaatagacacttcctgtgtatgtacattgaccattaaaaggggaagatag

DBGET integrated database retrieval system