KEGG   Ornithorhynchus anatinus (platypus): 100081779Help
Entry
100081779         CDS       T01045                                 

Gene name
NUP205
Definition
(RefSeq) nucleoporin 205kDa
  KO
K14310  
nuclear pore complex protein Nup205
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100081779 (NUP205)
Messenger RNA biogenesis [BR:oaa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100081779 (NUP205)
Chromosome [BR:oaa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100081779 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
ENSOANG00000005007
Position
10
AA seq 2000 aa AA seqDB search
MWGPYKDIWQSAGNAIWKRQPEAVHVVDLILKKHKPDFISYFLSQPKNVQQHEKIQKAST
EGVAIQGQQGTRLLPEQLIREAFILSDLFDIGELAAVELLLAGEHQQPHFPGLTRGLVAV
LLYWDGKRCVANSLKALIQSRRGKTWTLELSPELVSMTTRFTDELMEQGLTHKILTLVSQ
IDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSPLSKDDTLLLIGH
LERVTVEADGSLDSVNLALVMALLYCFDISFIEQGTEDREDLIHQLPLLTERQYIGSIHA
RLQDSQPWKLPGLQATVRLAWALALRGISQLSEVTALAEFTEADEAIAELAIADNVFLFL
TESIVGSENFYQEEFYIRKIHNLITNFLALMPMKVKQLRNRADEDARMIHVSLQMGNEPP
VTLRRDLEHLMLLVAELYKRNPFNLELALEYWCPTEPLQTSTIMGSYLGVAHQRPPQRQV
VLSKFVRQMGDLLPPTIYIPYLKMLQGLASGPQCAHYCFSLLKVNGSSHAENIQGAGGSP
VSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPLRGITQKEQDGLIAFLQLTTSIITWSE
NARLALCEHPQWTPVVVILGLLQCSIPPILKAELLKTLTAFGKSPEIAASLWQSLEYTQI
LQTVRVPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFPSNLGAGLRPPGF
DPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQLEDFVDQFVELQG
EEIIAYKPPGFNLMYHLLNESPMLELSLSLLEEGVKQLDTYAPFPGKKHLEKAVQHCLAL
LNLTLQKENLFTDLLRESQLALIVTPLEQLLQGINPRTKKADNVVNIARYLYHGNSNPEL
AFESAKILCCISCNSNIQIKLVGDFTHDQIISQKLMAGFVECLDSEDAEEFIDPEDESEP
EKKLARIRHDTRIHILNLLITSLERNPPNLALYLLGFELKKPVSTTNLQDPGVLGCPRTC
LHAILNILEKGTEGRTGPVAVKESPQLAELCYQVIYQLCACSDTSGPTMRYLRTSQDFLF
SQLQHLPFSNREYEISMLSQMSWLMKTASIELRVTSLNRQRSHTQRLLHLLLDDMPVKPY
LDGEGGIEEESRSVSGFLHFDTATKVRRKILSILDSIDFSQEIPEPLQLDFFDRAQIEQV
IANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEISTILQYVVERNKL
LQCLHAKRHTLESWRQLVEIILTACPQDLIQAEDRQLIIRDLLQDLHDKILDEDAAQELM
PVVAGAVFTLTAHLSQSVRTEQKQPLAISGPGESQYVLMLESSFGPAASEPTPVGFASIG
DSSLHIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDTLEAAKKTMWERL
TAPEDAFSKLQRENIAIIEGYGAALMEVVCRDACDGHEIGRMLALALLDRIVSVDKQQQW
LLYLSNSGYLKVLVDSLAEDDLTLQTLLTPQPPLLKALYTYESKMAFLTRVAKIQQGALE
LLRSGVIVRLAQCQVYDMRPETDHQGLFGLREPPVFIPAPVDRYRQILLPALQLCQVILT
SSMAQHLQAAGQVLQFLIAHSDTIQAILRCQDISAGSLQELALLTGIISKAALPGVLSEL
DPHVNDGSLMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKLQDDNVEGDRVSKRDEIELA
MQQICANVMEYCQSLMLQSSPTFQHAVCLFTPSLSETTNRDGPRQDSQAPVVPYWRLPGL
GIIVYLLKQSANDFFSYYDSHRQSVSKLQNVEQLPPDEIKELCQSVMPAGVDKISTAQKY
VLARRRLVKLINNRAKLLSLCSYIIETCLFLLWRHLEYYLLHCTPTDSQDSLLAPRTSFK
SRRLQDAFTSESNLDFRSGMTRVSQHDIDQLQIEAINTFGESLQKKLLDIEGLYSKVRSR
YSFIQALVRRIRGLLRISRG
NT seq 6003 nt NT seq  +upstreamnt  +downstreamnt
atgtgggggccatacaaagacatttggcagtcggcgggaaacgccatttggaagcggcaa
cctgaagccgtccacgttgttgatttgattttgaagaaacacaagcccgactttatctcg
tatttcctttcgcagccgaaaaacgttcagcagcatgagaagattcagaaagccagcacg
gagggagtcgccatccagggacagcagggaacgcgccttcttccagagcagctcatcaga
gaggcttttattctcagcgacctcttcgatatcggggagctggcggcagtcgaactgctc
ttggccggagagcaccagcagccacacttccctgggctaaccaggggcttagtagctgtc
cttttgtattgggatggaaagcgatgcgtcgccaattccctgaaagccctgattcagtct
cggcggggcaagacgtggacactggaactcagccctgagctggtgtccatgacaacccgc
tttacagatgagctgatggagcagggattgactcataagatcctgactctcgtgtcacag
attgatgtgaacaacgagttcgagaaactacagcgggagcgaggtttgggcagtgagaag
catcgcaaagaggtttcggatctcatcaaggaatgccggcagtctctggcagaaagcctt
tttgcctgggcctgccagtcccctttgagcaaagatgacaccctgcttcttattggccac
ttggaaagggtgaccgttgaagccgacggctctttggacagcgtgaacctggctctcgtc
atggctctcctctactgcttcgatatcagttttatcgagcagggtactgaggatcgagaa
gatctaattcatcagctccccctgttaacagagagacagtacattgggtcaatccatgct
cgccttcaagactctcaaccttggaaactccctggtttgcaggccactgttagacttgcc
tgggccctggcactgcgagggatctcccagctctcggaagtgaccgctcttgcagaattc
acggaagcggatgaagcaatagcagagcttgcaattgccgacaacgtcttccttttcctc
acggagtccatagtgggatcagaaaacttctaccaggaggaattctacatccggaaaatc
cataacctcatcaccaacttccttgcccttatgccaatgaaggtgaaacagctgcgaaac
cgagcagacgaagatgcccgtatgattcacgtgagcctgcagatgggtaacgagcctcct
gtcacgctgcggagggacctggaacatctcatgctactggtggcggagctgtacaaaagg
aatccctttaatttggagcttgctttagaatactggtgtccgaccgagcctctccagact
tccacaatcatggggtcttacctgggggtagctcatcaacgacctccgcaacgccaggtt
gtcctgtcaaagttcgtcaggcaaatgggggacctccttccgcccaccatttacattcca
tacctgaagatgctgcagggcctggcgagcggaccgcagtgcgcccactactgcttcagc
ctgctcaaagttaacggcagcagtcacgcggaaaacatccaaggagccggtggcagcccc
gtctcctgggagcacttcttccactctctgatgttatatcacgaacacttacggaaggac
ctgcctagcgcagatagcgtccagtaccgtcacttacccctccgaggcatcactcagaag
gagcaggatggattgattgcctttttgcagctcacaacctccatcatcacttggagtgaa
aatgctcgtttggccctctgcgagcaccctcagtggacgccggtggtagtaattctgggc
ctcctgcagtgtagcatccctcccattttgaaagccgagctgttgaagacacttaccgcc
tttggaaaatctcctgaaatagctgcttccctctggcagtccttggaatacacccagata
ttgcagaccgtacgggtcccaagccagaggcaagcaattggcattgaggtggagttgaat
gaaatagagtccaggtgtgaggagtaccctttgacccgcgccttttgccagcttatcagc
accctggtggagagttcctttccttctaacttgggggcgggactgcgcccgcccggcttc
gatccctacttgcagttcctcagagattccgtgttcctccgattccgcaccagagcttac
cggagagcagccgaaaagtgggaagttgcagaggtggttctggaggtgttttataaactg
ctgagagactatgaacctcaacttgaagattttgtggaccagtttgtggaattgcaagga
gaagaaatcatagcttacaagccacctggtttcaatctgatgtatcatcttctaaatgaa
tcgccaatgttggagctctcccttagtttattggaggaaggggttaagcagttggacact
tatgcaccgtttccggggaagaagcatttggagaaagcagtgcagcactgcctggcgctt
cttaacctcactctgcagaaagagaatctgttcacggaccttctgcgagaaagccagctg
gctctcatagtcacgccgctcgagcagttgctgcagggcatcaacccccggaccaaaaag
gcagacaacgtcgtcaacatcgctcggtatctttaccacggcaatagcaatccggaattg
gccttcgaaagtgccaagatcctctgctgtatctcttgcaactcaaacattcagataaag
ttagtgggcgacttcacacacgatcagataataagccagaaacttatggctggatttgtg
gagtgtttggacagtgaagatgcagaggaattcattgatcctgaagacgagtcagaacct
gaaaagaagctagctcgaatccgccatgacacgagaatccacatcttgaatcttctcatt
acttctctggagcgtaacccacccaaccttgctctttatcttctgggctttgaactgaag
aaacctgtcagcaccacaaacctgcaagacccaggcgttttgggttgcccccggacttgc
cttcacgctatcctgaatatcctggagaagggcaccgaagggagaaccggtcccgtggca
gtgaaagaatctccccagcttgcagagctgtgctaccaggtgatataccagctgtgtgcg
tgctcagatacatctggcccaactatgagatacttgagaaccagccaagatttcttattt
tctcaattgcagcatttgccattttccaacagagaatatgaaatatccatgctgagccag
atgtcgtggcttatgaagaccgcctcgatcgagctgcgggtgacttcgctcaaccgtcaa
cgctcccacacgcagcggctccttcacttgttgttggatgacatgcccgtcaaaccgtac
ttggatggtgaagggggaatagaagaggagagtaggtctgttagtggatttcttcatttt
gacactgccacaaaagtccgccgaaagatcctgagcatcttggactcgattgacttcagc
caggagatccccgagcctttgcaattagatttctttgatcgggctcagatcgagcaggtc
attgccaactgtgagcacaagaatctgcggggtcagacggtctgcaatgtcaagctcctt
cacagagtccttgtggccgaagtgaatgcccttcagggtatggcggccataggccagaga
cctttactcatggaggaaatcagcacaattcttcagtacgtggtggaacggaacaagctc
ttgcagtgccttcatgcgaagcggcacacgttggagtcgtggaggcagttggtggagatc
atcttgaccgcctgcccccaggatctcatccaggcggaagacaggcagctgatcatccgg
gaccttctgcaggatttgcacgataaaatactggacgaggacgcggcccaagagttaatg
ccggtggtggcgggggccgtgttcaccctgaccgcccacctgagtcagtcggtccgcacc
gagcagaagcagccgctggccatctcgggccccggagagtcccaatacgtgctcatgctg
gagagttctttcggccccgccgcctcggagcccacgcccgtggggtttgcttccatcggc
gattcatcactccacatcatactgaagaaacttttagacttcattttgaaaacaggaggc
gggttccagcgagtgaggactcacctgtacggctcgctgctctactatttgcagatcgcc
cagagaccagatgagccggacaccctagaagcagccaagaagaccatgtgggaacgcctg
acagctcccgaagacgccttcagtaaattgcagcgagaaaacatcgctatcattgagggg
tacggagccgccctcatggaggtggtgtgtcgagatgcctgtgatggtcacgagattggc
cggatgttggcactggctttgctcgatcggattgtctcggtggataaacagcagcagtgg
ctcctgtacctgtccaacagcggctatttgaaggttctcgtggacagtttagcggaagac
gatctcacgctgcaaaccttgcttacccctcagccaccccttttgaaagccctttacacg
tacgaatccaaaatggcattcctcacgagagtggcgaagatacagcaaggagctctggag
ctgttgaggtccggtgtgatagtgagattggcacagtgccaagtgtacgacatgcgccca
gagacggaccatcaaggactgttcggcctgagagaacctcccgttttcatccccgctccc
gtggatcggtatcgtcagattctcctcccagccctccagttgtgtcaggtcatcctcacg
tccagcatggcccaacacctgcaggccgcgggacaggtgttgcagtttctcatagcgcac
tccgacaccatccaggccatcctccgctgtcaggatatcagcgcgggctcactgcaggag
ttggccctgctcacgggaatcatcagcaaagcagccctgcccggtgtcctcagtgaactc
gatcctcacgtaaatgatggatctctgatggagctgcagggtcacataggacgattccag
cgtcagtgtttagggctcttaagtcgttttggtggttctgaccgactgcgacagttcaaa
ctccaggacgataacgtggaaggggaccgagtgagcaagagggatgagattgaactggct
atgcagcagatctgtgccaacgtcatggaatattgccagtcgctcatgttgcagagctcc
ccgaccttccagcatgcggtgtgccttttcacccccagtctgtcagaaaccaccaacaga
gacggaccccggcaagattctcaagctcccgtggtgccctattggcgcctgcccggcttg
ggcatcatcgtctacctgctgaagcagagcgccaacgacttcttcagctactacgacagt
catcggcagagcgtcagcaagctccagaatgtggaacagctccccccggatgagatcaaa
gagttatgccagtcggtgatgccggccggcgtggataaaatctcgaccgcccagaaatac
gtcttggcaaggcgacgtttggtgaagttgatcaacaatcgagcaaaattactctccctc
tgttcctatatcatagaaacctgcctcttcctcctgtggcgtcatctggagtactacctc
ttacactgtacccccaccgactcccaagattcgctcctcgcccccaggacttcctttaaa
agcagaaggctgcaagatgccttcacatcagaatctaacctggatttcagaagcggcatg
accagagtgagccagcacgacatagaccagcttcagatcgaagccatcaacacgtttgga
gagtcgctgcagaagaagctcctggatatcgaagggctgtattcgaaagtccggtcccgt
tacagtttcatccaagcgctcgtcagacgcatccgtggcttattaaggatatcccgaggc
tga

DBGET integrated database retrieval system