KEGG   Ornithorhynchus anatinus (platypus): 100081779Help
Entry
100081779         CDS       T01045                                 

Gene name
NUP205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:oaa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 2042 aa AA seqDB search
MRPRKYLQMEYQRGVSMWGPYKDIWQSAGNAIWKRQPEAVHVVDLILKKHKPDFISQRGQ
AAFGCQLPHQSFKVDADAYVDSQMMLQPKNVQQHEKIQKASTEGVAIQGQQGTRLLPEQL
IREAFILSDLFDIGELAAVELLLAGEHQQPHFPGLTRGLVAVLLYWDGKRCVANSLKALI
QSRRGKTWTLELSPELVSMTTRFTDELMEQGLTHKILTLVSQIDVNNEFEKLQRERGLGS
EKHRKEVSDLIKECRQSLAESLFAWACQSPLSKDDTLLLIGHLERVTVEADGSLDSVNLA
LVMALLYCFDISFIEQGTEDREDLIHQLPLLTERQYIGSIHARLQDSQPWKLPGLQATVR
LAWALALRGISQLSEVTALAEFTEADEAIAELAIADNVFLFLTESIVGSENFYQEEFYIR
KIHNLITNFLALMPMKVKQLRNRADEDARMIHVSLQMGNEPPVTLRRDLEHLMLLVAELY
KRNPFNLELALEYWCPTEPLQTSTIMGSYLGVAHQRPPQRQVVLSKFVRQMGDLLPPTIY
IPYLKMLQGLASGPQCAHYCFSLLKVNGSSHAENIQGAGGSPVSWEHFFHSLMLYHEHLR
KDLPSADSVQYRHLPLRGITQKEQDGLIAFLQLTTSIITWSENARLALCEHPQWTPVVVI
LGLLQCSIPPILKAELLKTLTAFGKSPEIAASLWQSLEYTQILQTVRVPSQRQAIGIEVE
LNEIESRCEEYPLTRAFCQLISTLVESSFPSNLGAGLRPPGFDPYLQFLRDSVFLRFRTR
AYRRAAEKWEVAEVVLEVFYKLLRDYEPQLEDFVDQFVELQGEEIIAYKPPGFNLMYHLL
NESPMLELSLSLLEEGVKQLDTYAPFPGKKHLEKAVQHCLALLNLTLQKENLFTDLLRES
QLALIVTPLEQLLQGINPRTKKADNVVNIARYLYHGNSNPELAFESAKILCCISCNSNIQ
IKLVGDFTHDQIISQKLMAGFVECLDSEDAEEFIDPEDESEPEKKLARIRHDTRIHILNL
LITSLERNPPNLALYLLGFELKKPVSTTNLQDPGVLGCPRTCLHAILNILEKGTEGRTGP
VAVKESPQLAELCYQVIYQLCACSDTSGPTMRYLRTSQDFLFSQLQHLPFSNREYEISML
SQMSWLMKTASIELRVTSLNRQRSHTQRLLHLLLDDMPVKPYLDGEGGIEEESRSVSGFL
HFDTATKVRRKILSILDSIDFSQEIPEPLQLDFFDRAQIEQVIANCEHKNLRGQTVCNVK
LLHRVLVAEVNALQGMAAIGQRPLLMEEISTILQYVVERNKLLQCLHAKRHTLESWRQLV
EIILTACPQDLIQAEDRQLIIRDLLQDLHDKILDEDAAQELMPVVAGAVFTLTAHLSQSV
RTEQKQPLAISGPGESQYVLMLESSFGPAASEPTPVGFASIGDSSLHIILKKLLDFILKT
GGGFQRVRTHLYGSLLYYLQIAQRPDEPDTLEAAKKTMWERLTAPEDAFSKLQRENIAII
EGYGAALMEVVCRDACDGHEIGRMLALALLDRIVSVDKQQQWLLYLSNSGYLKVLVDSLA
EDDLTLQTLLTPQPPLLKALYTYESKMAFLTRVAKIQQGALELLRSGVIVRLAQCQVYDM
RPETDHQGLFGLREPPVFIPAPVDRYRQILLPALQLCQVILTSSMAQHLQAAGQVLQFLI
AHSDTIQAILRCQDISAGSLQELALLTGIISKAALPGVLSELDPHVNDGSLMELQGHIGR
FQRQCLGLLSRFGGSDRLRQFKLQDDNVEGDRVSKRDEIELAMQQICANVMEYCQSLMLQ
SSPTFQHAVCLFTPSLSETTNRDGPRQDSQAPVVPYWRLPGLGIIVYLLKQSANDFFSYY
DSHRQSVSKLQNVEQLPPDEIKELCQSVMPAGVDKISTAQKYVLARRRLVKLINNRAKLL
SLCSYIIETCLFLLWRHLEYYLLHCTPTDSQDSLLAPRTSFKSRRLQDAFTSESNLDFRS
GMTRVSQHDIDQLQIEAINTFGESLQKKLLDIEGLYSKVRSRYSFIQALVRRIRGLLRIS
RG
NT seq 6129 nt NT seq  +upstreamnt  +downstreamnt
atgaggccgcgcaagtaccttcagatggaatatcagagaggtgttagcatgtgggggcca
tacaaagacatttggcagtcggcgggaaacgccatttggaagcggcaacctgaagccgtc
cacgttgttgatttgattttgaagaaacacaagcccgactttatctcgcagagggggcaa
gctgcgtttggctgccagttgccccatcagtcctttaaagttgatgccgatgcctatgtt
gattctcagatgatgctccagccgaaaaacgttcagcagcatgagaagattcagaaagcc
agcacggagggagtcgccatccagggacagcagggaacgcgccttcttccagagcagctc
atcagagaggcttttattctcagcgacctcttcgatatcggggagctggcggcagtcgaa
ctgctcttggccggagagcaccagcagccacacttccctgggctaaccaggggcttagta
gctgtccttttgtattgggatggaaagcgatgcgtcgccaattccctgaaagccctgatt
cagtctcggcggggcaagacgtggacactggaactcagccctgagctggtgtccatgaca
acccgctttacagatgagctgatggagcagggattgactcataagatcctgactctcgtg
tcacagattgatgtgaacaacgagttcgagaaactacagcgggagcgaggtttgggcagt
gagaagcatcgcaaagaggtttcggatctcatcaaggaatgccggcagtctctggcagaa
agcctttttgcctgggcctgccagtcccctttgagcaaagatgacaccctgcttcttatt
ggccacttggaaagggtgaccgttgaagccgacggctctttggacagcgtgaacctggct
ctcgtcatggctctcctctactgcttcgatatcagttttatcgagcagggtactgaggat
cgagaagatctaattcatcagctccccctgttaacagagagacagtacattgggtcaatc
catgctcgccttcaagactctcaaccttggaaactccctggtttgcaggccactgttaga
cttgcctgggccctggcactgcgagggatctcccagctctcggaagtgaccgctcttgca
gaattcacggaagcggatgaagcaatagcagagcttgcaattgccgacaacgtcttcctt
ttcctcacggagtccatagtgggatcagaaaacttctaccaggaggaattctacatccgg
aaaatccataacctcatcaccaacttccttgcccttatgccaatgaaggtgaaacagctg
cgaaaccgagcagacgaagatgcccgtatgattcacgtgagcctgcagatgggtaacgag
cctcctgtcacgctgcggagggacctggaacatctcatgctactggtggcggagctgtac
aaaaggaatccctttaatttggagcttgctttagaatactggtgtccgaccgagcctctc
cagacttccacaatcatggggtcttacctgggggtagctcatcaacgacctccgcaacgc
caggttgtcctgtcaaagttcgtcaggcaaatgggggacctccttccgcccaccatttac
attccatacctgaagatgctgcagggcctggcgagcggaccgcagtgcgcccactactgc
ttcagcctgctcaaagttaacggcagcagtcacgcggaaaacatccaaggagccggtggc
agccccgtctcctgggagcacttcttccactctctgatgttatatcacgaacacttacgg
aaggacctgcctagcgcagatagcgtccagtaccgtcacttacccctccgaggcatcact
cagaaggagcaggatggattgattgcctttttgcagctcacaacctccatcatcacttgg
agtgaaaatgctcgtttggccctctgcgagcaccctcagtggacgccggtggtagtaatt
ctgggcctcctgcagtgtagcatccctcccattttgaaagccgagctgttgaagacactt
accgcctttggaaaatctcctgaaatagctgcttccctctggcagtccttggaatacacc
cagatattgcagaccgtacgggtcccaagccagaggcaagcaattggcattgaggtggag
ttgaatgaaatagagtccaggtgtgaggagtaccctttgacccgcgccttttgccagctt
atcagcaccctggtggagagttcctttccttctaacttgggggcgggactgcgcccgccc
ggcttcgatccctacttgcagttcctcagagattccgtgttcctccgattccgcaccaga
gcttaccggagagcagccgaaaagtgggaagttgcagaggtggttctggaggtgttttat
aaactgctgagagactatgaacctcaacttgaagattttgtggaccagtttgtggaattg
caaggagaagaaatcatagcttacaagccacctggtttcaatctgatgtatcatcttcta
aatgaatcgccaatgttggagctctcccttagtttattggaggaaggggttaagcagttg
gacacttatgcaccgtttccggggaagaagcatttggagaaagcagtgcagcactgcctg
gcgcttcttaacctcactctgcagaaagagaatctgttcacggaccttctgcgagaaagc
cagctggctctcatagtcacgccgctcgagcagttgctgcagggcatcaacccccggacc
aaaaaggcagacaacgtcgtcaacatcgctcggtatctttaccacggcaatagcaatccg
gaattggccttcgaaagtgccaagatcctctgctgtatctcttgcaactcaaacattcag
ataaagttagtgggcgacttcacacacgatcagataataagccagaaacttatggctgga
tttgtggagtgtttggacagtgaagatgcagaggaattcattgatcctgaagacgagtca
gaacctgaaaagaagctagctcgaatccgccatgacacgagaatccacatcttgaatctt
ctcattacttctctggagcgtaacccacccaaccttgctctttatcttctgggctttgaa
ctgaagaaacctgtcagcaccacaaacctgcaagacccaggcgttttgggttgcccccgg
acttgccttcacgctatcctgaatatcctggagaagggcaccgaagggagaaccggtccc
gtggcagtgaaagaatctccccagcttgcagagctgtgctaccaggtgatataccagctg
tgtgcgtgctcagatacatctggcccaactatgagatacttgagaaccagccaagatttc
ttattttctcaattgcagcatttgccattttccaacagagaatatgaaatatccatgctg
agccagatgtcgtggcttatgaagaccgcctcgatcgagctgcgggtgacttcgctcaac
cgtcaacgctcccacacgcagcggctccttcacttgttgttggatgacatgcccgtcaaa
ccgtacttggatggtgaagggggaatagaagaggagagtaggtctgttagtggatttctt
cattttgacactgccacaaaagtccgccgaaagatcctgagcatcttggactcgattgac
ttcagccaggagatccccgagcctttgcaattagatttctttgatcgggctcagatcgag
caggtcattgccaactgtgagcacaagaatctgcggggtcagacggtctgcaatgtcaag
ctccttcacagagtccttgtggccgaagtgaatgcccttcagggtatggcggccataggc
cagagacctttactcatggaggaaatcagcacaattcttcagtacgtggtggaacggaac
aagctcttgcagtgccttcatgcgaagcggcacacgttggagtcgtggaggcagttggtg
gagatcatcttgaccgcctgcccccaggatctcatccaggcggaagacaggcagctgatc
atccgggaccttctgcaggatttgcacgataaaatactggacgaggacgcggcccaagag
ttaatgccggtggtggcgggggccgtgttcaccctgaccgcccacctgagtcagtcggtc
cgcaccgagcagaagcagccgctggccatctcgggccccggagagtcccaatacgtgctc
atgctggagagttctttcggccccgccgcctcggagcccacgcccgtggggtttgcttcc
atcggcgattcatcactccacatcatactgaagaaacttttagacttcattttgaaaaca
ggaggcgggttccagcgagtgaggactcacctgtacggctcgctgctctactatttgcag
atcgcccagagaccagatgagccggacaccctagaagcagccaagaagaccatgtgggaa
cgcctgacagctcccgaagacgccttcagtaaattgcagcgagaaaacatcgctatcatt
gaggggtacggagccgccctcatggaggtggtgtgtcgagatgcctgtgatggtcacgag
attggccggatgttggcactggctttgctcgatcggattgtctcggtggataaacagcag
cagtggctcctgtacctgtccaacagcggctatttgaaggttctcgtggacagtttagcg
gaagacgatctcacgctgcaaaccttgcttacccctcagccaccccttttgaaagccctt
tacacgtacgaatccaaaatggcattcctcacgagagtggcgaagatacagcaaggagct
ctggagctgttgaggtccggtgtgatagtgagattggcacagtgccaagtgtacgacatg
cgcccagagacggaccatcaaggactgttcggcctgagagaacctcccgttttcatcccc
gctcccgtggatcggtatcgtcagattctcctcccagccctccagttgtgtcaggtcatc
ctcacgtccagcatggcccaacacctgcaggccgcgggacaggtgttgcagtttctcata
gcgcactccgacaccatccaggccatcctccgctgtcaggatatcagcgcgggctcactg
caggagttggccctgctcacgggaatcatcagcaaagcagccctgcccggtgtcctcagt
gaactcgatcctcacgtaaatgatggatctctgatggagctgcagggtcacataggacga
ttccagcgtcagtgtttagggctcttaagtcgttttggtggttctgaccgactgcgacag
ttcaaactccaggacgataacgtggaaggggaccgagtgagcaagagggatgagattgaa
ctggctatgcagcagatctgtgccaacgtcatggaatattgccagtcgctcatgttgcag
agctccccgaccttccagcatgcggtgtgccttttcacccccagtctgtcagaaaccacc
aacagagacggaccccggcaagattctcaagctcccgtggtgccctattggcgcctgccc
ggcttgggcatcatcgtctacctgctgaagcagagcgccaacgacttcttcagctactac
gacagtcatcggcagagcgtcagcaagctccagaatgtggaacagctccccccggatgag
atcaaagagttatgccagtcggtgatgccggccggcgtggataaaatctcgaccgcccag
aaatacgtcttggcaaggcgacgtttggtgaagttgatcaacaatcgagcaaaattactc
tccctctgttcctatatcatagaaacctgcctcttcctcctgtggcgtcatctggagtac
tacctcttacactgtacccccaccgactcccaagattcgctcctcgcccccaggacttcc
tttaaaagcagaaggctgcaagatgccttcacatcagaatctaacctggatttcagaagc
ggcatgaccagagtgagccagcacgacatagaccagcttcagatcgaagccatcaacacg
tttggagagtcgctgcagaagaagctcctggatatcgaagggctgtattcgaaagtccgg
tcccgttacagtttcatccaagcgctcgtcagacgcatccgtggcttattaaggatatcc
cgaggctga

DBGET integrated database retrieval system