KEGG   Ornithorhynchus anatinus (platypus): 100081779Help
Entry
100081779         CDS       T01045                                 

Gene name
NUP205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100081779 (NUP205)
Messenger RNA biogenesis [BR:oaa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100081779 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 2032 aa AA seqDB search
MWGPYKDIWQSAGNAIWKRQPEAVHVVDLILKKHKPDFISSSEIIRQRGQAAFGCQLPHQ
SFKVDADAYVDSQMMLQPKNVQQHEKIQKASTEGVAIQGQQGTRLLPEQLIREAFILSDL
FDIGELAAVELLLAGEHQQPHFPGLTRGLVAVLLYWDGKRCVANSLKALIQSRRGKTWTL
ELSPELVSMTTRFTDELMEQGLTHKILTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDL
IKECRQSLAESLFAWACQSPLSKDDTLLLIGHLERVTVEADGSLDSVNLALVMALLYCFD
ISFIEQGTEDREDLIHQLPLLTERQYIGSIHARLQDSQPWKLPGLQATVRLAWALALRGI
SQLSEVTALAEFTEADEAIAELAIADNVFLFLTESIVGSENFYQEEFYIRKIHNLITNFL
ALMPMKVKQLRNRADEDARMIHVSLQMGNEPPVTLRRDLEHLMLLVAELYKRNPFNLELA
LEYWCPTEPLQTSTIMGSYLGVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGL
ASGPQCAHYCFSLLKVNGSSHAENIQGAGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQ
YRHLPLRGITQKEQDGLIAFLQLTTSIITWSENARLALCEHPQWTPVVVILGLLQCSIPP
ILKAELLKTLTAFGKSPEIAASLWQSLEYTQILQTVRVPSQRQAIGIEVELNEIESRCEE
YPLTRAFCQLISTLVESSFPSNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWE
VAEVVLEVFYKLLRDYEPQLEDFVDQFVELQGEEIIAYKPPGFNLMYHLLNESPMLELSL
SLLEEGVKQLDTYAPFPGKKHLEKAVQHCLALLNLTLQKENLFTDLLRESQLALIVTPLE
QLLQGINPRTKKADNVVNIARYLYHGNSNPELAFESAKILCCISCNSNIQIKLVGDFTHD
QIISQKLMAGFVECLDSEDAEEFIDPEDESEPEKKLARIRHDTRIHILNLLITSLERNPP
NLALYLLGFELKKPVSTTNLQDPGVLGCPRTCLHAILNILEKGTEGRTGPVAVKESPQLA
ELCYQVIYQLCACSDTSGPTMRYLRTSQDFLFSQLQHLPFSNREYEISMLSQMSWLMKTA
SIELRVTSLNRQRSHTQRLLHLLLDDMPVKPYLDGEGGIEEESRSVSGFLHFDTATKVRR
KILSILDSIDFSQEIPEPLQLDFFDRAQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEV
NALQGMAAIGQRPLLMEEISTILQYVVERNKLLQCLHAKRHTLESWRQLVEIILTACPQD
LIQAEDRQLIIRDLLQDLHDKILDEDAAQELMPVVAGAVFTLTAHLSQSVRTEQKQPLAI
SGPGESQYVLMLESSFGPAASEPTPVGFASIGDSSLHIILKKLLDFILKTGGGFQRVRTH
LYGSLLYYLQIAQRPDEPDTLEAAKKTMWERLTAPEDAFSKLQRENIAIIEGYGAALMEV
VCRDACDGHEIGRMLALALLDRIVSVDKQQQWLLYLSNSGYLKVLVDSLAEDDLTLQTLL
TPQPPLLKALYTYESKMAFLTRVAKIQQGALELLRSGVIVRLAQCQVYDMRPETDHQGLF
GLREPPVFIPAPVDRYRQILLPALQLCQVILTSSMAQHLQAAGQVLQFLIAHSDTIQAIL
RCQDISAGSLQELALLTGIISKAALPGVLSELDPHVNDGSLMELQGHIGRFQRQCLGLLS
RFGGSDRLRQFKLQDDNVEGDRVSKRDEIELAMQQICANVMEYCQSLMLQSSPTFQHAVC
LFTPSLSETTNRDGPRQDSQAPVVPYWRLPGLGIIVYLLKQSANDFFSYYDSHRQSVSKL
QNVEQLPPDEIKELCQSVMPAGVDKISTAQKYVLARRRLVKLINNRAKLLSLCSYIIETC
LFLLWRHLEYYLLHCTPTDSQDSLLAPRTSFKSRRLQDAFTSESNLDFRSGMTRVSQHDI
DQLQIEAINTFGESLQKKLLDIEGLYSKVRSRYSFIQALVRRIRGLLRISRG
NT seq 6099 nt NT seq  +upstreamnt  +downstreamnt
atgtgggggccatacaaagacatttggcagtcggcgggaaacgccatttggaagcggcaa
cctgaagccgtccacgttgttgatttgattttgaagaaacacaagcccgactttatctcg
tcctcagaaatcataaggcagagggggcaagctgcgtttggctgccagttgccccatcag
tcctttaaagttgatgccgatgcctatgttgattctcagatgatgctccagccgaaaaac
gttcagcagcatgagaagattcagaaagccagcacggagggagtcgccatccagggacag
cagggaacgcgccttcttccagagcagctcatcagagaggcttttattctcagcgacctc
ttcgatatcggggagctggcggcagtcgaactgctcttggccggagagcaccagcagcca
cacttccctgggctaaccaggggcttagtagctgtccttttgtattgggatggaaagcga
tgcgtcgccaattccctgaaagccctgattcagtctcggcggggcaagacgtggacactg
gaactcagccctgagctggtgtccatgacaacccgctttacagatgagctgatggagcag
ggattgactcataagatcctgactctcgtgtcacagattgatgtgaacaacgagttcgag
aaactacagcgggagcgaggtttgggcagtgagaagcatcgcaaagaggtttcggatctc
atcaaggaatgccggcagtctctggcagaaagcctttttgcctgggcctgccagtcccct
ttgagcaaagatgacaccctgcttcttattggccacttggaaagggtgaccgttgaagcc
gacggctctttggacagcgtgaacctggctctcgtcatggctctcctctactgcttcgat
atcagttttatcgagcagggtactgaggatcgagaagatctaattcatcagctccccctg
ttaacagagagacagtacattgggtcaatccatgctcgccttcaagactctcaaccttgg
aaactccctggtttgcaggccactgttagacttgcctgggccctggcactgcgagggatc
tcccagctctcggaagtgaccgctcttgcagaattcacggaagcggatgaagcaatagca
gagcttgcaattgccgacaacgtcttccttttcctcacggagtccatagtgggatcagaa
aacttctaccaggaggaattctacatccggaaaatccataacctcatcaccaacttcctt
gcccttatgccaatgaaggtgaaacagctgcgaaaccgagcagacgaagatgcccgtatg
attcacgtgagcctgcagatgggtaacgagcctcctgtcacgctgcggagggacctggaa
catctcatgctactggtggcggagctgtacaaaaggaatccctttaatttggagcttgct
ttagaatactggtgtccgaccgagcctctccagacttccacaatcatggggtcttacctg
ggggtagctcatcaacgacctccgcaacgccaggttgtcctgtcaaagttcgtcaggcaa
atgggggacctccttccgcccaccatttacattccatacctgaagatgctgcagggcctg
gcgagcggaccgcagtgcgcccactactgcttcagcctgctcaaagttaacggcagcagt
cacgcggaaaacatccaaggagccggtggcagccccgtctcctgggagcacttcttccac
tctctgatgttatatcacgaacacttacggaaggacctgcctagcgcagatagcgtccag
taccgtcacttacccctccgaggcatcactcagaaggagcaggatggattgattgccttt
ttgcagctcacaacctccatcatcacttggagtgaaaatgctcgtttggccctctgcgag
caccctcagtggacgccggtggtagtaattctgggcctcctgcagtgtagcatccctccc
attttgaaagccgagctgttgaagacacttaccgcctttggaaaatctcctgaaatagct
gcttccctctggcagtccttggaatacacccagatattgcagaccgtacgggtcccaagc
cagaggcaagcaattggcattgaggtggagttgaatgaaatagagtccaggtgtgaggag
taccctttgacccgcgccttttgccagcttatcagcaccctggtggagagttcctttcct
tctaacttgggggcgggactgcgcccgcccggcttcgatccctacttgcagttcctcaga
gattccgtgttcctccgattccgcaccagagcttaccggagagcagccgaaaagtgggaa
gttgcagaggtggttctggaggtgttttataaactgctgagagactatgaacctcaactt
gaagattttgtggaccagtttgtggaattgcaaggagaagaaatcatagcttacaagcca
cctggtttcaatctgatgtatcatcttctaaatgaatcgccaatgttggagctctccctt
agtttattggaggaaggggttaagcagttggacacttatgcaccgtttccggggaagaag
catttggagaaagcagtgcagcactgcctggcgcttcttaacctcactctgcagaaagag
aatctgttcacggaccttctgcgagaaagccagctggctctcatagtcacgccgctcgag
cagttgctgcagggcatcaacccccggaccaaaaaggcagacaacgtcgtcaacatcgct
cggtatctttaccacggcaatagcaatccggaattggccttcgaaagtgccaagatcctc
tgctgtatctcttgcaactcaaacattcagataaagttagtgggcgacttcacacacgat
cagataataagccagaaacttatggctggatttgtggagtgtttggacagtgaagatgca
gaggaattcattgatcctgaagacgagtcagaacctgaaaagaagctagctcgaatccgc
catgacacgagaatccacatcttgaatcttctcattacttctctggagcgtaacccaccc
aaccttgctctttatcttctgggctttgaactgaagaaacctgtcagcaccacaaacctg
caagacccaggcgttttgggttgcccccggacttgccttcacgctatcctgaatatcctg
gagaagggcaccgaagggagaaccggtcccgtggcagtgaaagaatctccccagcttgca
gagctgtgctaccaggtgatataccagctgtgtgcgtgctcagatacatctggcccaact
atgagatacttgagaaccagccaagatttcttattttctcaattgcagcatttgccattt
tccaacagagaatatgaaatatccatgctgagccagatgtcgtggcttatgaagaccgcc
tcgatcgagctgcgggtgacttcgctcaaccgtcaacgctcccacacgcagcggctcctt
cacttgttgttggatgacatgcccgtcaaaccgtacttggatggtgaagggggaatagaa
gaggagagtaggtctgttagtggatttcttcattttgacactgccacaaaagtccgccga
aagatcctgagcatcttggactcgattgacttcagccaggagatccccgagcctttgcaa
ttagatttctttgatcgggctcagatcgagcaggtcattgccaactgtgagcacaagaat
ctgcggggtcagacggtctgcaatgtcaagctccttcacagagtccttgtggccgaagtg
aatgcccttcagggtatggcggccataggccagagacctttactcatggaggaaatcagc
acaattcttcagtacgtggtggaacggaacaagctcttgcagtgccttcatgcgaagcgg
cacacgttggagtcgtggaggcagttggtggagatcatcttgaccgcctgcccccaggat
ctcatccaggcggaagacaggcagctgatcatccgggaccttctgcaggatttgcacgat
aaaatactggacgaggacgcggcccaagagttaatgccggtggtggcgggggccgtgttc
accctgaccgcccacctgagtcagtcggtccgcaccgagcagaagcagccgctggccatc
tcgggccccggagagtcccaatacgtgctcatgctggagagttctttcggccccgccgcc
tcggagcccacgcccgtggggtttgcttccatcggcgattcatcactccacatcatactg
aagaaacttttagacttcattttgaaaacaggaggcgggttccagcgagtgaggactcac
ctgtacggctcgctgctctactatttgcagatcgcccagagaccagatgagccggacacc
ctagaagcagccaagaagaccatgtgggaacgcctgacagctcccgaagacgccttcagt
aaattgcagcgagaaaacatcgctatcattgaggggtacggagccgccctcatggaggtg
gtgtgtcgagatgcctgtgatggtcacgagattggccggatgttggcactggctttgctc
gatcggattgtctcggtggataaacagcagcagtggctcctgtacctgtccaacagcggc
tatttgaaggttctcgtggacagtttagcggaagacgatctcacgctgcaaaccttgctt
acccctcagccaccccttttgaaagccctttacacgtacgaatccaaaatggcattcctc
acgagagtggcgaagatacagcaaggagctctggagctgttgaggtccggtgtgatagtg
agattggcacagtgccaagtgtacgacatgcgcccagagacggaccatcaaggactgttc
ggcctgagagaacctcccgttttcatccccgctcccgtggatcggtatcgtcagattctc
ctcccagccctccagttgtgtcaggtcatcctcacgtccagcatggcccaacacctgcag
gccgcgggacaggtgttgcagtttctcatagcgcactccgacaccatccaggccatcctc
cgctgtcaggatatcagcgcgggctcactgcaggagttggccctgctcacgggaatcatc
agcaaagcagccctgcccggtgtcctcagtgaactcgatcctcacgtaaatgatggatct
ctgatggagctgcagggtcacataggacgattccagcgtcagtgtttagggctcttaagt
cgttttggtggttctgaccgactgcgacagttcaaactccaggacgataacgtggaaggg
gaccgagtgagcaagagggatgagattgaactggctatgcagcagatctgtgccaacgtc
atggaatattgccagtcgctcatgttgcagagctccccgaccttccagcatgcggtgtgc
cttttcacccccagtctgtcagaaaccaccaacagagacggaccccggcaagattctcaa
gctcccgtggtgccctattggcgcctgcccggcttgggcatcatcgtctacctgctgaag
cagagcgccaacgacttcttcagctactacgacagtcatcggcagagcgtcagcaagctc
cagaatgtggaacagctccccccggatgagatcaaagagttatgccagtcggtgatgccg
gccggcgtggataaaatctcgaccgcccagaaatacgtcttggcaaggcgacgtttggtg
aagttgatcaacaatcgagcaaaattactctccctctgttcctatatcatagaaacctgc
ctcttcctcctgtggcgtcatctggagtactacctcttacactgtacccccaccgactcc
caagattcgctcctcgcccccaggacttcctttaaaagcagaaggctgcaagatgccttc
acatcagaatctaacctggatttcagaagcggcatgaccagagtgagccagcacgacata
gaccagcttcagatcgaagccatcaacacgtttggagagtcgctgcagaagaagctcctg
gatatcgaagggctgtattcgaaagtccggtcccgttacagtttcatccaagcgctcgtc
agacgcatccgtggcttattaaggatatcccgaggctga

DBGET integrated database retrieval system