KEGG   Ornithorhynchus anatinus (platypus): 100081779Help
Entry
100081779         CDS       T01045                                 

Gene name
NUP205
Definition
(RefSeq) nucleoporin 205
  KO
K14310  nuclear pore complex protein Nup205
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa03013  RNA transport
Module
oaa_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100081779 (NUP205)
Messenger RNA biogenesis [BR:oaa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100081779 (NUP205)
Chromosome and associated proteins [BR:oaa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100081779 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nup192
Motif
Other DBs
NCBI-GeneID: 100081779
NCBI-ProteinID: XP_016083850
Ensembl: ENSOANG00000005007
Position
10
AA seq 2000 aa AA seqDB search
MWGPYKDIWQSAGNAIWKRQPEAVHVVDLILKKHKPDFISYFLSQPKNVQQHEKIQKAST
EGVAIQGQQGTRLLPEQLIREAFILSDLFDIGELAAVELLLAGEHQQPHFPGLTRGLVAV
LLYWDGKRCVANSLKALIQSRRGKTWTLELSPELVSMTTRFTDELMEQGLTHKILTLVSQ
IDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSPLSKDDTLLLIGH
LERVTVEADGSLDSVNLALVMALLYCFDISFIEQGTEDREDLIHQLPLLTERQYIGSIHA
RLQDSQPWKLPGLQATVRLAWALALRGISQLSEVTALAEFTEADEAIAELAIADNVFLFL
TESIVGSENFYQEEFYIRKIHNLITNFLALMPMKVKQLRNRADEDARMIHVSLQMGNEPP
VTLRRDLEHLMLLVAELYKRNPFNLELALEYWCPTEPLQTSTIMGSYLGVAHQRPPQRQV
VLSKFVRQMGDLLPPTIYIPYLKMLQGLASGPQCAHYCFSLLKVNGSSHAENIQGAGGSP
VSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPLRGITQKEQDGLIAFLQLTTSIITWSE
NARLALCEHPQWTPVVVILGLLQCSIPPILKAELLKTLTAFGKSPEIAASLWQSLEYTQI
LQTVRVPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFPSNLGAGLRPPGF
DPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQLEDFVDQFVELQG
EEIIAYKPPGFNLMYHLLNESPMLELSLSLLEEGVKQLDTYAPFPGKKHLEKAVQHCLAL
LNLTLQKENLFTDLLRESQLALIVTPLEQLLQGINPRTKKADNVVNIARYLYHGNSNPEL
AFESAKILCCISCNSNIQIKLVGDFTHDQIISQKLMAGFVECLDSEDAEEFIDPEDESEP
EKKLARIRHDTRIHILNLLITSLERNPPNLALYLLGFELKKPVSTTNLQDPGVLGCPRTC
LHAILNILEKGTEGRTGPVAVKESPQLAELCYQVIYQLCACSDTSGPTMRYLRTSQDFLF
SQLQHLPFSNREYEISMLSQMSWLMKTASIELRVTSLNRQRSHTQRLLHLLLDDMPVKPY
LDGEGGIEEESRSVSGFLHFDTATKVRRKILSILDSIDFSQEIPEPLQLDFFDRAQIEQV
IANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEISTILQYVVERNKL
LQCLHAKRHTLESWRQLVEIILTACPQDLIQAEDRQLIIRDLLQDLHDKILDEDAAQELM
PVVAGAVFTLTAHLSQSVRTEQKQPLAISGPGESQYVLMLESSFGPAASEPTPVGFASIG
DSSLHIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDTLEAAKKTMWERL
TAPEDAFSKLQRENIAIIEGYGAALMEVVCRDACDGHEIGRMLALALLDRIVSVDKQQQW
LLYLSNSGYLKVLVDSLAEDDLTLQTLLTPQPPLLKALYTYESKMAFLTRVAKIQQGALE
LLRSGVIVRLAQCQVYDMRPETDHQGLFGLREPPVFIPAPVDRYRQILLPALQLCQVILT
SSMAQHLQAAGQVLQFLIAHSDTIQAILRCQDISAGSLQELALLTGIISKAALPGVLSEL
DPHVNDGSLMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKLQDDNVEGDRVSKRDEIELA
MQQICANVMEYCQSLMLQSSPTFQHAVCLFTPSLSETTNRDGPRQDSQAPVVPYWRLPGL
GIIVYLLKQSANDFFSYYDSHRQSVSKLQNVEQLPPDEIKELCQSVMPAGVDKISTAQKY
VLARRRLVKLINNRAKLLSLCSYIIETCLFLLWRHLEYYLLHCTPTDSQDSLLAPRTSFK
SRRLQDAFTSESNLDFRSGMTRVSQHDIDQLQIEAINTFGESLQKKLLDIEGLYSKVRSR
YSFIQALVRRIRGLLRISRG
NT seq 6003 nt NT seq  +upstreamnt  +downstreamnt
atgtgggggccatacaaagacatttggcagtcggcgggaaacgccatttggaagcggcaa
cctgaagccgtccacgttgttgatttgattttgaagaaacacaagcccgactttatctcg
tatttcctttcgcagccgaaaaacgttcagcagcatgagaagattcagaaagccagcacg
gagggagtcgccatccagggacagcagggaacgcgccttcttccagagcagctcatcaga
gaggcttttattctcagcgacctcttcgatatcggggagctggcggcagtcgaactgctc
ttggccggagagcaccagcagccacacttccctgggctaaccaggggcttagtagctgtc
cttttgtattgggatggaaagcgatgcgtcgccaattccctgaaagccctgattcagtct
cggcggggcaagacgtggacactggaactcagccctgagctggtgtccatgacaacccgc
tttacagatgagctgatggagcagggattgactcataagatcctgactctcgtgtcacag
attgatgtgaacaacgagttcgagaaactacagcgggagcgaggtttgggcagtgagaag
catcgcaaagaggtttcggatctcatcaaggaatgccggcagtctctggcagaaagcctt
tttgcctgggcctgccagtcccctttgagcaaagatgacaccctgcttcttattggccac
ttggaaagggtgaccgttgaagccgacggctctttggacagcgtgaacctggctctcgtc
atggctctcctctactgcttcgatatcagttttatcgagcagggtactgaggatcgagaa
gatctaattcatcagctccccctgttaacagagagacagtacattgggtcaatccatgct
cgccttcaagactctcaaccttggaaactccctggtttgcaggccactgttagacttgcc
tgggccctggcactgcgagggatctcccagctctcggaagtgaccgctcttgcagaattc
acggaagcggatgaagcaatagcagagcttgcaattgccgacaacgtcttccttttcctc
acggagtccatagtgggatcagaaaacttctaccaggaggaattctacatccggaaaatc
cataacctcatcaccaacttccttgcccttatgccaatgaaggtgaaacagctgcgaaac
cgagcagacgaagatgcccgtatgattcacgtgagcctgcagatgggtaacgagcctcct
gtcacgctgcggagggacctggaacatctcatgctactggtggcggagctgtacaaaagg
aatccctttaatttggagcttgctttagaatactggtgtccgaccgagcctctccagact
tccacaatcatggggtcttacctgggggtagctcatcaacgacctccgcaacgccaggtt
gtcctgtcaaagttcgtcaggcaaatgggggacctccttccgcccaccatttacattcca
tacctgaagatgctgcagggcctggcgagcggaccgcagtgcgcccactactgcttcagc
ctgctcaaagttaacggcagcagtcacgcggaaaacatccaaggagccggtggcagcccc
gtctcctgggagcacttcttccactctctgatgttatatcacgaacacttacggaaggac
ctgcctagcgcagatagcgtccagtaccgtcacttacccctccgaggcatcactcagaag
gagcaggatggattgattgcctttttgcagctcacaacctccatcatcacttggagtgaa
aatgctcgtttggccctctgcgagcaccctcagtggacgccggtggtagtaattctgggc
ctcctgcagtgtagcatccctcccattttgaaagccgagctgttgaagacacttaccgcc
tttggaaaatctcctgaaatagctgcttccctctggcagtccttggaatacacccagata
ttgcagaccgtacgggtcccaagccagaggcaagcaattggcattgaggtggagttgaat
gaaatagagtccaggtgtgaggagtaccctttgacccgcgccttttgccagcttatcagc
accctggtggagagttcctttccttctaacttgggggcgggactgcgcccgcccggcttc
gatccctacttgcagttcctcagagattccgtgttcctccgattccgcaccagagcttac
cggagagcagccgaaaagtgggaagttgcagaggtggttctggaggtgttttataaactg
ctgagagactatgaacctcaacttgaagattttgtggaccagtttgtggaattgcaagga
gaagaaatcatagcttacaagccacctggtttcaatctgatgtatcatcttctaaatgaa
tcgccaatgttggagctctcccttagtttattggaggaaggggttaagcagttggacact
tatgcaccgtttccggggaagaagcatttggagaaagcagtgcagcactgcctggcgctt
cttaacctcactctgcagaaagagaatctgttcacggaccttctgcgagaaagccagctg
gctctcatagtcacgccgctcgagcagttgctgcagggcatcaacccccggaccaaaaag
gcagacaacgtcgtcaacatcgctcggtatctttaccacggcaatagcaatccggaattg
gccttcgaaagtgccaagatcctctgctgtatctcttgcaactcaaacattcagataaag
ttagtgggcgacttcacacacgatcagataataagccagaaacttatggctggatttgtg
gagtgtttggacagtgaagatgcagaggaattcattgatcctgaagacgagtcagaacct
gaaaagaagctagctcgaatccgccatgacacgagaatccacatcttgaatcttctcatt
acttctctggagcgtaacccacccaaccttgctctttatcttctgggctttgaactgaag
aaacctgtcagcaccacaaacctgcaagacccaggcgttttgggttgcccccggacttgc
cttcacgctatcctgaatatcctggagaagggcaccgaagggagaaccggtcccgtggca
gtgaaagaatctccccagcttgcagagctgtgctaccaggtgatataccagctgtgtgcg
tgctcagatacatctggcccaactatgagatacttgagaaccagccaagatttcttattt
tctcaattgcagcatttgccattttccaacagagaatatgaaatatccatgctgagccag
atgtcgtggcttatgaagaccgcctcgatcgagctgcgggtgacttcgctcaaccgtcaa
cgctcccacacgcagcggctccttcacttgttgttggatgacatgcccgtcaaaccgtac
ttggatggtgaagggggaatagaagaggagagtaggtctgttagtggatttcttcatttt
gacactgccacaaaagtccgccgaaagatcctgagcatcttggactcgattgacttcagc
caggagatccccgagcctttgcaattagatttctttgatcgggctcagatcgagcaggtc
attgccaactgtgagcacaagaatctgcggggtcagacggtctgcaatgtcaagctcctt
cacagagtccttgtggccgaagtgaatgcccttcagggtatggcggccataggccagaga
cctttactcatggaggaaatcagcacaattcttcagtacgtggtggaacggaacaagctc
ttgcagtgccttcatgcgaagcggcacacgttggagtcgtggaggcagttggtggagatc
atcttgaccgcctgcccccaggatctcatccaggcggaagacaggcagctgatcatccgg
gaccttctgcaggatttgcacgataaaatactggacgaggacgcggcccaagagttaatg
ccggtggtggcgggggccgtgttcaccctgaccgcccacctgagtcagtcggtccgcacc
gagcagaagcagccgctggccatctcgggccccggagagtcccaatacgtgctcatgctg
gagagttctttcggccccgccgcctcggagcccacgcccgtggggtttgcttccatcggc
gattcatcactccacatcatactgaagaaacttttagacttcattttgaaaacaggaggc
gggttccagcgagtgaggactcacctgtacggctcgctgctctactatttgcagatcgcc
cagagaccagatgagccggacaccctagaagcagccaagaagaccatgtgggaacgcctg
acagctcccgaagacgccttcagtaaattgcagcgagaaaacatcgctatcattgagggg
tacggagccgccctcatggaggtggtgtgtcgagatgcctgtgatggtcacgagattggc
cggatgttggcactggctttgctcgatcggattgtctcggtggataaacagcagcagtgg
ctcctgtacctgtccaacagcggctatttgaaggttctcgtggacagtttagcggaagac
gatctcacgctgcaaaccttgcttacccctcagccaccccttttgaaagccctttacacg
tacgaatccaaaatggcattcctcacgagagtggcgaagatacagcaaggagctctggag
ctgttgaggtccggtgtgatagtgagattggcacagtgccaagtgtacgacatgcgccca
gagacggaccatcaaggactgttcggcctgagagaacctcccgttttcatccccgctccc
gtggatcggtatcgtcagattctcctcccagccctccagttgtgtcaggtcatcctcacg
tccagcatggcccaacacctgcaggccgcgggacaggtgttgcagtttctcatagcgcac
tccgacaccatccaggccatcctccgctgtcaggatatcagcgcgggctcactgcaggag
ttggccctgctcacgggaatcatcagcaaagcagccctgcccggtgtcctcagtgaactc
gatcctcacgtaaatgatggatctctgatggagctgcagggtcacataggacgattccag
cgtcagtgtttagggctcttaagtcgttttggtggttctgaccgactgcgacagttcaaa
ctccaggacgataacgtggaaggggaccgagtgagcaagagggatgagattgaactggct
atgcagcagatctgtgccaacgtcatggaatattgccagtcgctcatgttgcagagctcc
ccgaccttccagcatgcggtgtgccttttcacccccagtctgtcagaaaccaccaacaga
gacggaccccggcaagattctcaagctcccgtggtgccctattggcgcctgcccggcttg
ggcatcatcgtctacctgctgaagcagagcgccaacgacttcttcagctactacgacagt
catcggcagagcgtcagcaagctccagaatgtggaacagctccccccggatgagatcaaa
gagttatgccagtcggtgatgccggccggcgtggataaaatctcgaccgcccagaaatac
gtcttggcaaggcgacgtttggtgaagttgatcaacaatcgagcaaaattactctccctc
tgttcctatatcatagaaacctgcctcttcctcctgtggcgtcatctggagtactacctc
ttacactgtacccccaccgactcccaagattcgctcctcgcccccaggacttcctttaaa
agcagaaggctgcaagatgccttcacatcagaatctaacctggatttcagaagcggcatg
accagagtgagccagcacgacatagaccagcttcagatcgaagccatcaacacgtttgga
gagtcgctgcagaagaagctcctggatatcgaagggctgtattcgaaagtccggtcccgt
tacagtttcatccaagcgctcgtcagacgcatccgtggcttattaaggatatcccgaggc
tga

DBGET integrated database retrieval system