KEGG   Ornithorhynchus anatinus (platypus): 100081782Help
Entry
100081782         CDS       T01045                                 

Gene name
ARHGAP5
Definition
Rho GTPase activating protein 5
Orthology
K13709  
Rho GTPase-activating protein 5
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Focal adhesion
Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100081782 (ARHGAP5)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100081782 (ARHGAP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 1499 aa AA seqDB search
MAKNKEPRPPSYAISVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYNLEHTSVLSTID
FGGRVVNNDHFLYWGDVTQSGEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYVKRAAL
SKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFVN
NLYIQLSKSKKPIIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNVETCFTA
LVQMLDKTRGKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNHP
DYEEYINLEGTKKAKSTFSKHIEQLRQEHIRKRREEYINTLPRALSTLLPNLEEIEHLNW
SEALKLMEKRADFHISFVVLEKTPWDETDHIDKVNDRRIPYDLLSTLEAEKVYQNHVQHL
ISEKRRVEMKEKFKKTLEKIPFISPGQPWEEVMCFVMEDEAFKYITEADSKEVYSRHQRE
IVDKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHRVLSEEPQYKALQKLAPDRESL
LLKHIGFVYHPTKETCLSGQGCTDIKVEQLLANSLLQLDHGRLRLYHDSANLDKVNLFIL
GKDGLAQELANEIRTQSTDDEYALDGKIYELDLQPVDSKSPYLLSQLWTAAFKPHGCFCV
FNSIESLNSIGECIGKIRNEASQNRRDKYMATLPFTLILANQRDSVSKNLPILRHQGQQL
ANKLQCPFVDVPTGTYPRKFNETQIKQALRGVLESVKHNLDVVSPVPINKDISEADLRIV
MCAMCGDPFSVDLILSPFLESHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSIG
VRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKELM
TEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSENTRESTHPS
EDVFLPSSRGFPYNNYPDSEDDTEAPPPYSPIGDDVQLLPTPSSKYRLDLEGNEYPIHST
PNSHDHERNHKVPPPIKPKPALPKTNVKKLDPNLLKTIEAGIGKNPRKQSSRVTLAHPED
MDPSDNYAEPNDTLFKPKGFSEDIYAVPDDSQNRTMKIRNSFGNNAQGDEENGFLDRTSK
NLGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFPTSKTKRKGRHRGSEEDPLLSP
VETWKGGIDNPAITSDQELDDKKMKKKTHKVKEDKKKKKTKTFNPPTRRNWESNYFGMPL
QELVSAEKPIPLFVEKCVEFIENTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNINLVSME
VTVNAVAGALKAFFADLPDPLIPYSLHPELLETSKLLDKTERLNALKEIVKKFHPVNYEV
FKYVITHLNRVSRQNKTNLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVETFIQQ
CQFFFHNGEIVETTNPVAPQPPSLNPGQMAEPMVPLQLPPPLQPQLIQPQLQADPLGII
NT seq 4500 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaataaagagcctcgacccccatcctatgctatcagtgtagtaggactctct
gggacagaaaaagacaaaggcaattgtggagttggcaagtcatgtctgtgcaatagattt
gtgcgttcgaaggccgacgagtataaccttgagcatacctctgtgcttagcacaattgac
tttggaggccgagtagtcaacaatgatcactttctctactggggtgacgtaacccaaagt
ggtgaagatggagtagaatgcaaaattcacgtcatcgaacagacggagttcatcgacgat
cagactttcttgcctcaccggagtacgaatctgcaaccgtacgtaaagcgtgcagcgctc
tccaaattgcagtcggcagaaaaactaatgtacatttgcactgatcaactaggcctggag
caagactttgagcagaaacagatgccggaagggaagcttaatgtagatgggtttttgtta
tgcattgatgtgagtcagggctgcaataggaaatttgacgatcagcttaaatttgtgaat
aacctatatatccagctatcaaaatcgaaaaaacccataataatagcagcaactaaatgt
gacgaatgtgtggatcattatcttcgagaggtccaggcgtttgcctcaaacaaaaagaac
ctcctcgtagtggagacgtcggcaaggttcaatgtcaacgttgaaacgtgtttcactgcg
ctggtacaaatgttggataaaacccggggaaaacctaaaattattccctatctggatgct
tataaaacacagcgacaacttgttgtcacagcaacggataaatttgaaaaacttgtgcaa
actgtgagagattatcatgcaacttggaaaactgttagtaataaattaaaaaaccatccg
gattacgaggagtatataaacctggagggaacaaaaaaggccaaaagtacgttttcaaaa
cacatcgagcaactcagacaggagcatataaggaaaagaagagaagaatatatcaataca
ctcccaagggcacttagcacccttctgccaaacctggaagagattgaacatttgaactgg
tccgaagccctgaaactgatggagaaaagagcagactttcatatttcctttgtggtgctt
gaaaaaacaccttgggatgaaacagaccacattgacaaagtcaatgatcgaaggatccca
tatgatctacttagcactttagaagccgaaaaggtctatcaaaaccacgtccaacatctt
atatctgagaagaggagggtagaaatgaaggaaaagttcaaaaagaccctggaaaaaata
ccgtttatttcacccgggcaaccttgggaagaagttatgtgttttgtaatggaggatgaa
gctttcaaatacatcactgaagcagatagcaaagaggtgtatagtaggcatcagcgagag
atagttgacaaagccaaagaagagtttcaggaaatgctgtttgaacattccgagctgttt
tatgatctagatctgaatgcaacacccagttcagataagatgagtgagattcacagggtc
ctgagcgaagagcctcaatataaagctttacagaaacttgctcctgatcgggagtctctt
ctacttaaacacattggatttgtttatcatcccacgaaagaaacctgtcttagtggccag
ggttgcacagacataaaagttgagcagctgcttgccaatagtcttttgcagctagaccat
ggtcgcctccgattgtaccacgatagtgctaacttagataaggtgaatctctttattcta
ggtaaggatggtcttgcccaagagctagcaaatgagataaggacgcagtccaccgatgat
gagtatgccctggatggaaaaatttacgaactggatcttcagccagttgattccaagtcc
ccttaccttctaagtcagttgtggactgctgctttcaaaccacacggatgcttctgtgtt
tttaattctatcgagtcgctgaacagtatcggggaatgtatcggaaaaatacgaaatgaa
gcctctcagaacaggagagataaatatatggccactcttccgtttacgctaattttggct
aatcagagggacagcgtcagcaagaatttaccgattctcaggcaccaggggcagcagttg
gcaaacaaattgcagtgtccctttgtagatgttcccaccggtacttaccctcgaaagttt
aatgagactcagataaagcaagccctgagaggagtgttggaatcggtgaaacacaatctg
gacgtggtaagccccgttcccatcaataaagacatttcagaagccgacctgagaatcgtt
atgtgtgccatgtgcggcgatccatttagtgtcgatctcattctttcacctttccttgag
tctcactcgtgcagtgctgctcaggctggacagaataattctttaatgctggataagatc
ataggtgagaaaaggagaagaatacagataaccatattatcctaccattcttccatcgga
gtaaggaaagatgaactggttcatggctacattttggtctattctgccaaacggaaagcg
tccatgggaatgcttcgagcgtttctttcagaagttcaagacactattcctgttcaactg
gtagccgtgaccgatagtcaagcggattttttcgagaatgaggctattaaggagttaatg
acagaaggagagcacatagcaacagaaattactgctaaattcaccgcattgtattctttg
tctcagtatcaccgacaaactgaggtcttcacgttgtttttcagtgatgttttagaaaaa
aaaaatatgatagaaaactcctatttgtctgagaacaccagggaatcaacccacccgagt
gaagatgttttccttccgtcttcgagaggcttcccttataataactatccagattcagaa
gacgatactgaagccccaccaccttacagtccaattggggatgatgtgcagctgctcccc
accccgagttccaaatatcgactagatttggaagggaatgaataccctattcacagcact
ccaaactctcatgaccacgagcgcaaccataaagtgcctccacctataaaacccaaacca
gctctaccgaagacaaatgtaaagaaactggatcctaatctgctaaagacaattgaggca
gggattggaaagaaccccaggaaacagtcctctcgagtgactctggcacatccagaggat
atggatccctcagataattatgcagaacctaatgatactctttttaaaccaaaaggcttt
tcggaggatatctatgctgtccccgacgatagtcagaatcggactatgaaaattcgaaat
tcatttggaaataatgcccagggtgacgaagaaaacggctttttggataggacatccaag
aaccttggggagaggcggccttcaaaatacaaatacaaatctaaaacactgtttagcaag
gccaagtcgtactataggagaacacattcagatgcaagcgatgatgaagctttccctact
tctaaaacaaagcgaaaaggaaggcatcgtggaagtgaagaagatccacttctttcccct
gtggaaacttggaaaggtggcattgacaaccctgctattacttcagatcaggagttggat
gataaaaaaatgaagaagaaaacacacaaagtaaaggaagacaagaagaaaaagaaaact
aagactttcaatccaccaactcgtagaaattgggaaagtaattacttcgggatgcctctt
caggagctggtttcagctgagaagcctataccactatttgttgaaaaatgtgtggaattt
attgaaaatacaggactgtgtactgaaggtctctacagggttagtgggaataaaacggat
caagacaacattcaaaagcagtttgatcaagatcataatatcaaccttgtatcgatggaa
gtgacggtcaatgctgtagctggagctctaaaagcgttttttgcagatcttccggatcct
ttaatcccatactcacttcatccagagctattagaaacatcaaaactcctggataaaaca
gaacggcttaatgcattaaaagagattgtgaagaaatttcatcctgtaaattatgaggtt
ttcaaatatgtaataactcatctaaacagggtcagtcgtcaaaacaagaccaacctcatg
accgccgacaacttgtctatctgtttttggccaactctgatgagacctgattttgaaaat
cgagagtttctgtccaccaccaagatccatcagtctgtggtcgagaccttcattcagcag
tgtcagtttttctttcacaatggagaaattgtagaaactactaaccccgtggctcctcag
ccgccatccttgaacccaggacagatggcggaaccaatggtcccacttcagttaccacca
cccctgcaacctcagctgatccaaccacaactacaggcagatcctcttggcattatataa

DBGET integrated database retrieval system