KEGG   Ornithorhynchus anatinus (platypus): 100081829Help
Entry
100081829         CDS       T01045                                 

Definition
RNA 3'-terminal phosphate cyclase-like
Orthology
K01974  
RNA 3'-terminal phosphate cyclase (ATP) [EC:6.5.1.4]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 448 aa AA seqDB search
MWEPKISETDMRGFGKVPQHTDSGPAWLLHGGYIPFHRKSTGKGGRGRGRGGRLRGDGGG
VGAVSLRSGGGGVEAGACAGPGGVVGGVSLRLRSVGASAWPVGGGHRAGPHPDAAPWRPS
GSRSMAGSWKGPQHLSGLEMVRDLCEGRLEGGEIGSTEITFTPGKIKGGTHTADTKTAGS
VCLLMQVSMPCVLFAASPSQLYLKGGTNAEMAPQIDYTVMVFKPIVEKFGFTFACDIKMR
GYYPKGGGEVVIRMSPVKQLNAINITDRGTVTKIYGRTFVAGVLPLKIAKDMAAAAVRCI
RKEIRDLYVNVQPVQEPKDQAFGNGNGIIIIAETSTGCMFAGSALGKRGVYADRVGIEAA
EMLLSNLRHGGAVDEYMQDQLIIFMALASGVSRIKTGPITLHTQTAIYFAEQLTKAKFTI
NKSEDEDDSSKETYIIECQGIGMTNPNL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaaccaaagatttctgagactgacatgagaggatttggcaaagtgcctcaacat
acagattcaggtcctgcttggctgctccatggaggttacattccattccatcgaaagtca
actggaaagggggggcgggggcgtggtcgaggcgggcgcctgcgcggcgacgggggcggg
gtcggggcggtgagcctgcgcagtggcgggggcggggtcgaggccggcgcctgcgcgggg
ccggggggcgtggtcggaggcgtgagcctgcgcctgcgcagtgtgggggcttcggcgtgg
ccggtgggtggcgggcaccgggccggtcctcaccccgacgccgcaccatggcggcccagc
gggtcgaggtcgatggcgggatcctggaaggggcctcaacacctctctggactggagatg
gttcgagatctgtgtgaggggcgcctggagggaggagaaatcggctcaacagaaataacc
tttacacctggaaagatcaagggcggcactcatacggcagataccaagacagcagggagt
gtgtgtctgttgatgcaggtctcaatgccctgtgttctgtttgcggcttccccgtcacag
ctgtacttgaaaggagggacgaatgctgaaatggccccacaaattgactatacagtaatg
gtcttcaagccgattgttgaaaaatttggtttcacgtttgcctgtgacattaaaatgagg
ggctactatcccaaggggggtggcgaagtggttattcgaatgtcaccggttaaacagttg
aatgcaataaatataactgaccgtggcactgtgacaaagatatatggaagaacttttgtt
gctggtgttctgcctttgaaaatagcaaaagatatggcagcagcagcagtgagatgcatc
agaaaagaaatcagggatctgtacgttaacgtccagcctgttcaggaacctaaagaccaa
gcctttggcaatggaaatggaataatcattattgctgagacatcaacaggctgtatgttt
gctggatcagcacttggtaaaagaggtgtgtatgctgacagggttggaattgaagctgca
gagatgctactaagtaatcttagacatggtggtgctgtggatgagtatatgcaagaccag
ttgattattttcatggcgttggccagcggggtctcgagaatcaagacaggaccaattacg
ctccacacacaaactgcaatatatttcgctgagcagctaacaaaggctaaatttactatt
aacaaatcagaagatgaggatgattcttctaaagaaacttacattattgaatgccaagga
attgggatgacaaatccaaatttgtaa

DBGET integrated database retrieval system